RegulonDB RegulonDB 10.8: Gene Form
   

casB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cas3 casA casC casB LeuO CRP LeuO H-NS LeuO LeuO SlyA TSS_3043 TSS_3043 casAp casAp

Gene      
Name: casB    Texpresso search in the literature
Synonym(s): ECK2754, G7429, b2759, cse2, ygcK
Genome position(nucleotides): 2882155 <-- 2882637 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.38
External database links:  
ASAP:
ABE-0009048
ECHOBASE:
EB2919
OU-MICROARRAY:
b2759
PortEco:
casB
STRING:
511145.b2759
COLOMBOS: casB


Product      
Name: type I-E CRISPR system Cascade subunit CasB
Synonym(s): CasB, Cascade subunit B, Cse2, YgcK
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 18.701
Isoelectric point: 10.16
Motif(s):
 
Type Positions Sequence
23 -> 150 AQIRRVSEPDELRDIPAFYRLVQPFGWENPRHQQALLRMVFCLSAGKNVIRHQDKKSEQTTGISLGRALANSGRINERRIFQLIRADRTADMVQLRRLLTHAEPVLDWPLMARMLTWWGKRERQQLLE

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
Gene Ontology Terms (GO)  
cellular_component GO:0032991 - protein-containing complex
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003723 - RNA binding
biological_process GO:0051607 - defense response to virus
Note(s): Note(s): ...[more].
Reference(s): [1] Nam KH., et al., 2012
External database links:  
DIP:
DIP-12127N
ECOCYC:
G7429-MONOMER
ECOLIWIKI:
b2759
INTERPRO:
IPR013382
INTERPRO:
IPR038287
PDB:
5H9F
PDB:
5H9E
PDB:
4U7U
PDB:
4TVX
PDB:
4QYZ
PDB:
5CD4
PFAM:
PF09485
PRIDE:
P76632
REFSEQ:
NP_417239
SMR:
P76632
UNIPROT:
P76632


Operon      
Name: casABCDE12         
Operon arrangement:
Transcription unit        Promoter
ygbF
casABCDE12
casDE-ygbTF


Transcriptional Regulation      
Display Regulation             
Activated by: LeuO, SlyA
Repressed by: CRP, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3043 2884659 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Nam KH., Huang Q., Ke A., 2012, Nucleic acid binding surface and dimer interface revealed by CRISPR-associated CasB protein structures., FEBS Lett 586(22):3956-61

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB