RegulonDB RegulonDB 10.8: Gene Form
   

ygcQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygcS ygcQ ygcR ygcP

Gene      
Name: ygcQ    Texpresso search in the literature
Synonym(s): ECK2764, G7435, b2769
Genome position(nucleotides): 2894919 <-- 2895779 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.63
External database links:  
ASAP:
ABE-0009077
ECHOBASE:
EB2925
OU-MICROARRAY:
b2769
PortEco:
ygcQ
STRING:
511145.b2769
COLOMBOS: ygcQ


Product      
Name: putative flavoprotein
Synonym(s): YgcQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 30.308
Isoelectric point: 4.813
Motif(s):
 
Type Positions Sequence
165 -> 244 LAEARRVLVVGQGGEADNQEIAMLAEKLGAEVGYSRARVMNGGVDAEKVIGISGHLLAPEVCIVVGASGAAALMAGVRNS
225 -> 253 VCIVVGASGAAALMAGVRNSKFVVAINHD
41 -> 130 AEQVLDALVEQWQRTPADVVLFPPGTFGDELSTRLAWRLHGASICQVTSLDIPTVSVRKSHWGNALTATLQTEKRPLCLSLARQAGAAKN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
molecular_function GO:0009055 - electron transfer activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0003995 - acyl-CoA dehydrogenase activity
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7435-MONOMER
ECOLIWIKI:
b2769
INTERPRO:
IPR014729
INTERPRO:
IPR029035
INTERPRO:
IPR014731
INTERPRO:
IPR014730
INTERPRO:
IPR001308
MODBASE:
Q46907
PFAM:
PF00766
PFAM:
PF01012
PRIDE:
Q46907
PROSITE:
PS00696
REFSEQ:
NP_417249
SMR:
Q46907
UNIPROT:
Q46907


Operon      
Name: ygcRQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB