RegulonDB RegulonDB 10.7: Gene Form
   

ygcU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygcU ygcS ygcW ygcR ygcUp5 ygcUp5

Gene      
Name: ygcU    Texpresso search in the literature
Synonym(s): ECK2767, G7439, b2772, b2773, b4463, ygcT, ygcV
Genome position(nucleotides): 2897964 <-- 2899418 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.52
External database links:  
ASAP:
ABE-0174094
ECHOBASE:
EB2929
MIM:
600121
OU-MICROARRAY:
b2773
PORTECO:
ygcU
REGULONDB:
b4463
STRING:
511145.b4463
M3D: ygcU
COLOMBOS: ygcU
PortEco: b2773


Product      
Name: putative FAD-containing dehydrogenase
Synonym(s): YgcT, YgcU, YgcV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.737
Isoelectric point: 6.364
Motif(s):
 
Type Positions Sequence
47 -> 226 TLPIPAAVVKLGSTEQVSRVLNFMNAHKINGVPRTGASATEGGLETVVENSVVLDGSAMNQIINIDIENMQATAQCGVPLEVLENALREKGYTTGHSPQSKPLAQMGGLVATRSIGQFSTLYGAIEDMVVGLEAVLADGTVTRIKNVPRRAAGPDIRHIIIGNEGALCYITEVTVKIFKF
51 -> 190 PAAVVKLGSTEQVSRVLNFMNAHKINGVPRTGASATEGGLETVVENSVVLDGSAMNQIINIDIENMQATAQCGVPLEVLENALREKGYTTGHSPQSKPLAQMGGLVATRSIGQFSTLYGAIEDMVVGLEAVLADGTVTRI
229 -> 478 ENNLFYGYILEDMKTGFNILREIMVEGYRPSIARLYDAEDGTQHFTHFADGKCVLIFMAEGNPRIAKVTGEGIAEIVARYPQCQRVDSKLIETWFNNLNWGPDKVAAERVQILKTGNMGFTTEVSGCWSCIHEIYESVINRIRTEFPHADDITMLGGHSSHSYQNGTNMYFVYDYNVVDCKPEEEIDKYHNPLNKIICEETIRLGGSMVHHHGIGKHRVHWSKLEHGSAWALLEGLKKQFDPNGIMNTGT

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0071949 - FAD binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12136N
ECOCYC:
G7439-MONOMER
ECOLIWIKI:
b4463
INTERPRO:
IPR006094
INTERPRO:
IPR004113
INTERPRO:
IPR016164
INTERPRO:
IPR016166
INTERPRO:
IPR016167
INTERPRO:
IPR016169
INTERPRO:
IPR036318
MODBASE:
Q46911
PANTHER:
PTHR11748:SF3
PFAM:
PF01565
PFAM:
PF02913
PRIDE:
Q46911
PROSITE:
PS51387
PROTEINMODELPORTAL:
Q46911
REFSEQ:
YP_026183
SMR:
Q46911
UNIPROT:
Q46911


Operon      
Name: ygcU         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygcUp5 2899607 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB