RegulonDB RegulonDB 10.7: Gene Form
   

ygcW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygcU yqcE ygcW terminator yqcEp6 yqcEp6 ygcWp12 ygcWp12 ygcWp11 ygcWp11 ygcUp5 ygcUp5

Gene      
Name: ygcW    Texpresso search in the literature
Synonym(s): ECK2768, G7440, b2774
Genome position(nucleotides): 2899488 <-- 2900273 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.67
External database links:  
ASAP:
ABE-0009088
ECHOBASE:
EB2930
OU-MICROARRAY:
b2774
PORTECO:
ygcW
REGULONDB:
b2774
STRING:
511145.b2774
M3D: ygcW
COLOMBOS: ygcW
PortEco: b2774


Product      
Name: putative deoxygluconate dehydrogenase
Synonym(s): YgcW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.042
Isoelectric point: 5.041
Motif(s):
 
Type Positions Sequence
22 -> 46 IVTGGNSGLGQAFAMALAKAGANIF
28 -> 258 SGLGQAFAMALAKAGANIFIPSFVKDNGETKEMIEKQGVEVDFMQVGITAEGAPQKIIAACCERFGTVDILVNNAGICKLNKVLDFGRADWDPMIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFSYLGGQWSPAYSATKHALAGFTKAYCDELGQYNIQVNGIAPGYYATDITLATRSNPETNQRVLDHIPANRWGDTQDLMGAAVFLASPASNYVNGHLLVVDGGY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12137N
ECOCYC:
G7440-MONOMER
ECOLIWIKI:
b2774
INTERPRO:
IPR036291
INTERPRO:
IPR002347
INTERPRO:
IPR020904
MINT:
MINT-1246789
MODBASE:
P76633
PANTHER:
PTHR24322
PFAM:
PF13561
PRIDE:
P76633
PRINTS:
PR00080
PRINTS:
PR00081
PROSITE:
PS00061
PROTEINMODELPORTAL:
P76633
REFSEQ:
NP_417254
SMR:
P76633
UNIPROT:
P76633


Operon      
Name: ygcW         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygcUp5 2899607 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygcWp11 2900409 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygcWp12 2900471 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqcEp6 2900472 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB