RegulonDB RegulonDB 10.7: Gene Form
   

queE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygcE queE yqcG ygcGp6 ygcGp6 queEp7 queEp7 ygcGp7 ygcGp7

Gene      
Name: queE    Texpresso search in the literature
Synonym(s): ECK2771, G7443, b2777, ygcF
Genome position(nucleotides): 2904747 <-- 2905418 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.64
External database links:  
ASAP:
ABE-0009101
ECHOBASE:
EB2849
OU-MICROARRAY:
b2777
PORTECO:
ygcF
REGULONDB:
b2777
STRING:
511145.b2777
M3D: queE
COLOMBOS: queE
PortEco: b2777


Product      
Name: putative 7-carboxy-7-deazaguanine synthase QueE
Synonym(s): QueE, YgcF, putative CDG synthase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.03
Isoelectric point: 5.957
Motif(s):
 
Type Positions Sequence
27 -> 132 RLQGCPVGCAWCDTKHTWEKLEDREVSLFSILAKTKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETSGTHEVRCTPNTW
24 -> 128 IFIRLQGCPVGCAWCDTKHTWEKLEDREVSLFSILAKTKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETSGTHEVRCT
12 -> 14 LQG
136 -> 138 SPK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032153 - cell division site
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016840 - carbon-nitrogen lyase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0000287 - magnesium ion binding
GO:1904047 - S-adenosyl-L-methionine binding
biological_process GO:0008616 - queuosine biosynthetic process
GO:0032466 - negative regulation of cytokinesis
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48192N
ECOCYC:
G7443-MONOMER
ECOLIWIKI:
b2777
INTERPRO:
IPR024924
INTERPRO:
IPR013785
INTERPRO:
IPR007197
INTERPRO:
IPR027609
PFAM:
PF04055
PRIDE:
P64554
PROTEINMODELPORTAL:
P64554
REFSEQ:
NP_417257
SMR:
P64554
UNIPROT:
P64554


Operon      
Name: queE         
Operon arrangement:
Transcription unit        Promoter
queE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygcGp7 2905605 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter queEp7 2905606 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygcGp6 2905666 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB