RegulonDB RegulonDB 10.8: Gene Form
   

gudX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gudP gudX gudD gudDp1 gudDp1

Gene      
Name: gudX    Texpresso search in the literature
Synonym(s): ECK2782, G7446, b2788, ygcY
Genome position(nucleotides): 2919406 <-- 2920746 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.99
External database links:  
ASAP:
ABE-0009136
ECHOBASE:
EB2960
OU-MICROARRAY:
b2788
PortEco:
gudX
STRING:
511145.b2788
COLOMBOS: gudX


Product      
Name: glucarate dehydratase-related protein
Synonym(s): GlucDRP, GudX, YgcY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.85
Isoelectric point: 6.02
Motif(s):
 
Type Positions Sequence
338 -> 340 HSN
187 -> 405 VVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWLLDEAISLCKGLNDVLTYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHAVMLNAVDIPLADPHFWTLSGAVRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGNPTAIDTHWIWQEGDCRLTQNPLEIKNGKIAVPDAPGLGVELDWEQ
234 -> 236 DPN
39 -> 136 IVVLTDNAGHTGIGEAPGGDVIYQTLVDAIPMVLGQEVARLNKVVQQVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALLDLLGKALNVPVCELLG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0046872 - metal ion binding
biological_process GO:0009063 - cellular amino acid catabolic process
GO:0044248 - cellular catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7446-MONOMER
ECOLIWIKI:
b2788
INTERPRO:
IPR034598
INTERPRO:
IPR036849
INTERPRO:
IPR034593
INTERPRO:
IPR029065
INTERPRO:
IPR029017
INTERPRO:
IPR018110
INTERPRO:
IPR013341
INTERPRO:
IPR013342
MODBASE:
Q46915
PANTHER:
PTHR43287
PDB:
4IL0
PDB:
4GYP
PFAM:
PF02746
PFAM:
PF13378
PRIDE:
Q46915
PRODB:
PRO_000022854
PROSITE:
PS00908
REFSEQ:
NP_417268
SMART:
SM00922
SMR:
Q46915
SWISSMODEL:
Q46915
UNIPROT:
Q46915


Operon      
Name: gudPXD         
Operon arrangement:
Transcription unit        Promoter
gudPXD


Transcriptional Regulation      
Display Regulation             
Activated by: CdaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gudDp1 2919513 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB