RegulonDB RegulonDB 10.8: Gene Form
   

truC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

truC yqcA csrB yqcC csrBp csrBp TSS_3108 (cluster) TSS_3108 (cluster) TSS_3107 TSS_3107 TSS_3106 TSS_3106 TSS_3105 TSS_3105 TSS_3104 TSS_3104 TSS_3103 (cluster) TSS_3103 (cluster) TSS_3102 (cluster) TSS_3102 (cluster) TSS_3101 TSS_3101 TSS_3100 TSS_3100 TSS_3099 TSS_3099 TSS_3098 (cluster) TSS_3098 (cluster) TSS_3097 TSS_3097 TSS_3096 (cluster) TSS_3096 (cluster) TSS_3095 TSS_3095 TSS_3094 TSS_3094 TSS_3093 TSS_3093 TSS_3092 TSS_3092 TSS_3091 TSS_3091 TSS_3090 TSS_3090 TSS_3089 TSS_3089 yqcAp5 yqcAp5

Gene      
Name: truC    Texpresso search in the literature
Synonym(s): ECK2785, G7449, b2791, yqcB
Genome position(nucleotides): 2923002 <-- 2923784 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.02
External database links:  
ASAP:
ABE-0009147
ECHOBASE:
EB2963
OU-MICROARRAY:
b2791
PortEco:
truC
STRING:
511145.b2791
COLOMBOS: truC


Product      
Name: tRNA pseudouridine65 synthase
Synonym(s): TruC, YqcB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.666
Isoelectric point: 7.102
Motif(s):
 
Type Positions Sequence
11 -> 170 LVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGVLLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFAREDKGPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLAH
54 -> 54 D

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0106029 - tRNA pseudouridine synthase activity
GO:0016853 - isomerase activity
GO:0003723 - RNA binding
GO:0009982 - pseudouridine synthase activity
biological_process GO:0006399 - tRNA metabolic process
GO:0009451 - RNA modification
GO:0001522 - pseudouridine synthesis
GO:0031119 - tRNA pseudouridine synthesis
GO:0008033 - tRNA processing
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7449-MONOMER
ECOLIWIKI:
b2791
INTERPRO:
IPR006224
INTERPRO:
IPR020103
INTERPRO:
IPR006145
PFAM:
PF00849
PRIDE:
P0AA41
PRODB:
PRO_000024127
PROSITE:
PS01129
REFSEQ:
NP_417271
SMR:
P0AA41
UNIPROT:
P0AA41


Operon      
Name: yqcC-truC-yqcA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqcAp5 2923050 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3089 2923556 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3090 2924137 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3091 2924349 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3092 2924385 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3093 2924391 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3094 2924394 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3095 2924415 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3096 (cluster) 2924424 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3097 2924436 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3098 (cluster) 2924452 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3099 2924464 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3100 2924466 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3101 2924468 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3102 (cluster) 2924473 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3103 (cluster) 2924477 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3104 2924484 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3105 2924496 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3106 2924507 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3107 2924509 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3108 (cluster) 2924522 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB