RegulonDB RegulonDB 10.8: Gene Form
   

queF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ppnN queF syd terminator TSS_3114 TSS_3114 TSS_3113 TSS_3113 TSS_3112 TSS_3112 sydp2 sydp2 queFp queFp TSS_3111 TSS_3111

Gene      
Name: queF    Texpresso search in the literature
Synonym(s): ECK2789, G7452, b2794, yqcD
Genome position(nucleotides): 2925348 --> 2926196 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.88
External database links:  
ASAP:
ABE-0009162
ECHOBASE:
EB2965
OU-MICROARRAY:
b2794
PortEco:
queF
STRING:
511145.b2794
COLOMBOS: queF


Product      
Name: 7-cyano-7-deazaguanine reductase
Synonym(s): QueF, YqcD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.587
Isoelectric point: 6.046
Motif(s):
 
Type Positions Sequence
228 -> 228 F
230 -> 230 E
190 -> 190 C
196 -> 270 PDWGSLQIQYRGRQIDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWRSNS
258 -> 259 RG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0046857 - oxidoreductase activity, acting on other nitrogenous compounds as donors, with NAD or NADP as acceptor
GO:0033739 - preQ1 synthase activity
biological_process GO:0008616 - queuosine biosynthetic process
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-12848N
ECOCYC:
G7452-MONOMER
ECOLIWIKI:
b2794
INTERPRO:
IPR016428
INTERPRO:
IPR029500
INTERPRO:
IPR029139
MINT:
MINT-1288325
PFAM:
PF14819
PFAM:
PF14489
PRIDE:
Q46920
PRODB:
PRO_000023670
REFSEQ:
NP_417274
SMR:
Q46920
UNIPROT:
Q46920


Operon      
Name: queF         
Operon arrangement:
Transcription unit        Promoter
queF


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3111 2925313 reverse nd [RS-EPT-CBR] [1]
  promoter sydp2 2925369 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_3112 2926272 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3113 2926407 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3114 2926537 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB