RegulonDB RegulonDB 10.8: Gene Form
   

csdA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csdA tcdA csdE ygdI TSS_3121 TSS_3121 ygdIp10 ygdIp10 ygdIp7 ygdIp7 TSS_3120 TSS_3120 csdAp3 csdAp3

Gene      
Name: csdA    Texpresso search in the literature
Synonym(s): ECK2806, G7454, b2810, ygdJ
Genome position(nucleotides): 2943337 --> 2944542 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.89
External database links:  
ASAP:
ABE-0009218
ECHOBASE:
EB2891
OU-MICROARRAY:
b2810
PortEco:
csdA
STRING:
511145.b2810
COLOMBOS: csdA


Product      
Name: cysteine sulfinate desulfinase
Synonym(s): CsdA, YgdJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.234
Isoelectric point: 5.207
Motif(s):
 
Type Positions Sequence
100 -> 100 C
323 -> 323 C
358 -> 358 C
21 -> 388 VYLDSAATALKPEAVVEATQQFYSLSAGNVHRSQFAEAQRLTARYEAAREKVAQLLNAPDDKTIVWTRGTTESINMVAQCYARPRLQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGPTGIGVLYGKSELLEAMSPWLGGGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAESWSRSLATLAEDALAKRPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHCAQPLLAELGVTGTLRASFAPYNTKSDVDAL
176 -> 176 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.13 - amino acid conversion
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016829 - lyase activity
GO:0016783 - sulfurtransferase activity
GO:0009000 - selenocysteine lyase activity
GO:0031071 - cysteine desulfurase activity
GO:0030170 - pyridoxal phosphate binding
biological_process GO:0000096 - sulfur amino acid metabolic process
GO:0016226 - iron-sulfur cluster assembly
External database links:  
DIP:
DIP-9323N
ECOCYC:
G7454-MONOMER
ECOLIWIKI:
b2810
INTERPRO:
IPR015424
INTERPRO:
IPR015422
INTERPRO:
IPR000192
INTERPRO:
IPR015421
INTERPRO:
IPR020578
INTERPRO:
IPR022471
MODBASE:
Q46925
PDB:
5FT6
PDB:
5FT5
PDB:
5FT4
PDB:
4LW4
PDB:
4LW2
PDB:
5FT8
PFAM:
PF00266
PRIDE:
Q46925
PRODB:
PRO_000022335
PROSITE:
PS00595
REFSEQ:
NP_417290
SMR:
Q46925
SWISSMODEL:
Q46925
UNIPROT:
Q46925


Operon      
Name: csdAE         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter csdAp3 2943207 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3120 2943213 reverse nd [RS-EPT-CBR] [2]
  promoter ygdIp7 2943229 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygdIp10 2943263 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3121 2943319 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB