RegulonDB RegulonDB 10.8: Gene Form
   

csdE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csdA tcdA csdE ygdI TSS_3121 TSS_3121 ygdIp10 ygdIp10 ygdIp7 ygdIp7 TSS_3120 TSS_3120 csdAp3 csdAp3

Gene      
Name: csdE    Texpresso search in the literature
Synonym(s): ECK2807, G7455, b2811, ygdK
Genome position(nucleotides): 2944542 --> 2944985 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.5
External database links:  
ASAP:
ABE-0009220
ECHOBASE:
EB2892
OU-MICROARRAY:
b2811
PortEco:
csdE
STRING:
511145.b2811
COLOMBOS: csdE


Product      
Name: sulfur acceptor protein CsdE
Synonym(s): CSD sulfur transfer protein CsdE, CsdE, YgdK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.94
Isoelectric point: 6.532
Motif(s):
 
Type Positions Sequence
23 -> 140 TFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAI
61 -> 61 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0097163 - sulfur carrier activity
biological_process GO:0061504 - cyclic threonylcarbamoyladenosine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12143N
ECOCYC:
G7455-MONOMER
ECOLIWIKI:
b2811
INTERPRO:
IPR003808
INTERPRO:
IPR017763
MODBASE:
P0AGF2
PANTHER:
PTHR43597
PDB:
5NQ6
PDB:
5EEP
PDB:
1NI7
PDB:
5FT8
PFAM:
PF02657
PRIDE:
P0AGF2
REFSEQ:
NP_417291
SMR:
P0AGF2
SWISSMODEL:
P0AGF2
UNIPROT:
P0AGF2


Operon      
Name: csdAE         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter csdAp3 2943207 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3120 2943213 reverse nd [RS-EPT-CBR] [2]
  promoter ygdIp7 2943229 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygdIp10 2943263 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3121 2943319 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB