RegulonDB RegulonDB 9.4: Gene Form
   

yqeF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqeG yqeF kduI anti-anti-terminator anti-terminator terminator terminator yqeGp8 yqeGp8 yqeFp11 yqeFp11 yqeGp5 yqeGp5 yqeGp1 yqeGp1 yqeFp8 yqeFp8 yqeFp1 yqeFp1 TSS_3141 TSS_3141 kduIp5 kduIp5

Gene      
Name: yqeF    Texpresso search in the literature
Synonym(s): ECK2842, b2844
Genome position(nucleotides): 2984411 <-- 2985592 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.55
External database links:  
OU-MICROARRAY:
b2844
M3D: yqeF
COLOMBOS: yqeF
PortEco: b2844


Product      
Name: predicted acyltransferase
Synonym(s): B2844, YqeF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.019
Isoelectric point: 5.66
Motif(s):
 
Type Positions Sequence
270 -> 391 PVLARIRAFASVGVDPALMGIAPVYATRRCLERVGWQLAEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRNARKGLATLCIGGGQGVALTIER
4 -> 261 VVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAGAGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSRAPHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYALSSQQKARAAIDAGRFKDEIVPVMTQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGSVTAGNASSINDGAAAVMMMSE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0003985 - acetyl-CoA C-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
GO:0003988 - acetyl-CoA C-acyltransferase activity
biological_process GO:0008152 - metabolic process
GO:0071271 - 1-butanol biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Dellomonaco C., et al., 2011
[2] Riley M., et al., 2006
External database links:  
ECOCYC:
G7464-MONOMER


Operon      
Name: yqeF         
Operon arrangement:
Transcription unit        Promoter
yqeF


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter kduIp5 2984194 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_3141 2985613 reverse nd [RS-EPT-CBR] [4]
  promoter yqeFp1 2985624 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yqeFp8 2985701 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yqeGp1 2985719 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yqeGp5 2985741 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yqeFp11 2985809 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yqeGp8 2985819 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Dellomonaco C., Clomburg JM., Miller EN., Gonzalez R., 2011, Engineered reversal of the β-oxidation cycle for the synthesis of fuels and chemicals., Nature. 476(7360):355-9

 [2] Riley M., Abe T., Arnaud MB., Berlyn MK., Blattner FR., Chaudhuri RR., Glasner JD., Horiuchi T., Keseler IM., Kosuge T., Mori H., Perna NT., Plunkett G., Rudd KE., Serres MH., Thomas GH., Thomson NR., Wishart D., Wanner BL., 2006, Escherichia coli K-12: a cooperatively developed annotation snapshot--2005., Nucleic Acids Res. 34(1):1-9

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol. 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB