RegulonDB RegulonDB 10.8: Gene Form
   

yqeI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqeI yqeH yqeJ yqeL yqeIp5 yqeIp5 yqeIp6 yqeIp6 yqeIp7 yqeIp7 yqeIp8 yqeIp8 yqeIp1 yqeIp1

Gene      
Name: yqeI    Texpresso search in the literature
Synonym(s): ECK2845, G7467, b2847
Genome position(nucleotides): 2988502 --> 2989311 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.63
External database links:  
ASAP:
ABE-0009352
ECHOBASE:
EB2903
OU-MICROARRAY:
b2847
PortEco:
yqeI
STRING:
511145.b2847
COLOMBOS: yqeI


Product      
Name: putative transcriptional regulator YqeI
Synonym(s): YqeI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 30.85
Isoelectric point: 8.902
Motif(s):
 
Type Positions Sequence
153 -> 173 IKSHLIMLSAFVIGAYSAYWL
3 -> 105 WIINDNIEFWPEHRKLISVHNADLNVVLTTPASRCLSLLLEAFPDVVAQQDFFTRVWEEEGMRVPTNTLYQNISIIRRGFRAVGDTTHSLIATVPRRGFKIHN
28 -> 102 VVLTTPASRCLSLLLEAFPDVVAQQDFFTRVWEEEGMRVPTNTLYQNISIIRRGFRAVGDTTHSLIATVPRRGFK

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005887 - integral component of plasma membrane
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-12856N
ECOCYC:
G7467-MONOMER
ECOLIWIKI:
b2847
INTERPRO:
IPR001867
INTERPRO:
IPR036388
INTERPRO:
IPR016032
MINT:
MINT-1271068
MODBASE:
Q46942
PFAM:
PF00486
PRIDE:
Q46942
PROSITE:
PS51755
REFSEQ:
NP_417324
SMART:
SM00862
SMR:
Q46942
UNIPROT:
Q46942


Operon      
Name: yqeIJ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqeIp1 2988344 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yqeIp8 2988415 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yqeIp7 2988423 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yqeIp6 2988431 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yqeIp5 2988436 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB