RegulonDB RegulonDB 10.8: Gene Form
   

insD4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD4 insD4 ygeO insC4 ygeP ygeN TSS_3142 (cluster) TSS_3142 (cluster)

Gene      
Name: insD4    Texpresso search in the literature
Synonym(s): ECK0358, G7480, b2860, yi22-4
Genome position(nucleotides): 2996372 <-- 2997277 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.08
External database links:  
ASAP:
ABE-0009395
ECOO157CYC:
Z0322
OU-MICROARRAY:
b2860
PortEco:
insD-4
COLOMBOS: insD4


Product      
Name: IS2 insertion element protein InsB
Synonym(s): InsD4
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 34.398
Isoelectric point: 9.121
Motif(s):
 
Type Positions Sequence
124 -> 243 ESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRD
62 -> 104 ELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLE
106 -> 289 KPAVPPSKRAHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0006310 - DNA recombination
GO:0032196 - transposition
GO:0015074 - DNA integration
External database links:  
ECOCYC:
MONOMER0-4448
INTERPRO:
IPR012337
INTERPRO:
IPR036397
INTERPRO:
IPR025948
INTERPRO:
IPR001584
PFAM:
PF00665
PFAM:
PF13276
PRIDE:
P0CF56
PROSITE:
PS50994
REFSEQ:
NP_417337
SMR:
P0CF56
UNIPROT:
P0CF56


Operon      
Name: insCD4C4D4-ygeON         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3142 (cluster) 2997629 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB