RegulonDB RegulonDB 10.8: Gene Form
   

insC4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD4 insD4 ygeQ insC4 ygeP TSS_3142 (cluster) TSS_3142 (cluster)

Gene      
Name: insC4    Texpresso search in the literature
Synonym(s): ECK0357, G7481, b2861, yi21-4
Genome position(nucleotides): 2997235 <-- 2997600 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.01
External database links:  
ASAP:
ABE-0009397
ECOO157CYC:
Z0365
ECOO157CYC:
Z4315
ECOO157CYC:
Z3154
ECOO157CYC:
Z1927
ECOO157CYC:
Z5096
ECOO157CYC:
Z1826
OU-MICROARRAY:
b2861
PortEco:
insC-4
STRING:
511145.b4272
COLOMBOS: insC4


Product      
Name: IS2 insertion element repressor InsA
Synonym(s): InsC4
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.452
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
8 -> 87 EKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
External database links:  
DIP:
DIP-28108N
ECOCYC:
MONOMER0-4252
ECOLIWIKI:
b2861
INTERPRO:
IPR002514
INTERPRO:
IPR009057
PFAM:
PF01527
PRIDE:
P0CF43
REFSEQ:
NP_417338
SMR:
P0CF43
UNIPROT:
P0CF43


Operon      
Name: insCD4C4D4-ygeON         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3142 (cluster) 2997629 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB