RegulonDB RegulonDB 10.9: Gene Form
   

xdhA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xdhA xdhB ygeR xdhC Fis xdhAp2 xdhAp2 xdhAp xdhAp ygeRp1 ygeRp1 TSS_3145 TSS_3145

Gene      
Name: xdhA    Texpresso search in the literature
Synonym(s): ECK2862, G7485, b2866, ygeS
Genome position(nucleotides): 3000345 --> 3002603 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.99
Reference(s): [1] Xi H., et al., 2000
External database links:  
ASAP:
ABE-0009413
ECHOBASE:
EB2861
ECOLIHUB:
xdhA
OU-MICROARRAY:
b2866
STRING:
511145.b2866
COLOMBOS: xdhA


Product      
Name: putative xanthine dehydrogenase molybdenum-binding subunit XdhA
Synonym(s): XdhA, YgeS
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 81.321
Isoelectric point: 6.287
Motif(s):
 
Type Positions Sequence
145 -> 687 GGNLLKQSTMSTGNVQQTIDAADYQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVRVIKPFVGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMGVNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAGAMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECLEKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINVQSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPALRSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERGGQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHGGMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLP
10 -> 126 TGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQARSLPGVLAIFTWEDVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARDELTAEKAAQLVSIEWQELP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides
Gene Ontology Terms (GO)  
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004854 - xanthine dehydrogenase activity
biological_process GO:0006144 - purine nucleobase metabolic process
GO:0006166 - purine ribonucleoside salvage
GO:0055114 - oxidation-reduction process
GO:0009114 - hypoxanthine catabolic process
Note(s): Note(s): ...[more].
Reference(s): [2] Serres MH., et al., 2001
[1] Xi H., et al., 2000
External database links:  
ECOCYC:
G7485-MONOMER
ECOLIWIKI:
b2866
INTERPRO:
IPR000674
INTERPRO:
IPR008274
INTERPRO:
IPR036856
INTERPRO:
IPR037165
MODBASE:
Q46799
PFAM:
PF02738
PFAM:
PF01315
PRIDE:
Q46799
PRODB:
PRO_000024231
REFSEQ:
NP_417342
SMART:
SM01008
SMR:
Q46799
UNIPROT:
Q46799


Operon      
Name: xdhABC         
Operon arrangement:
Transcription unit        Promoter
xdhABC
xdhABC


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3145 2999918 reverse nd [RS-EPT-CBR] [3]
  promoter ygeRp1 3000039 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Xi H., Schneider BL., Reitzer L., 2000, Purine catabolism in Escherichia coli and function of xanthine dehydrogenase in purine salvage., J Bacteriol 182(19):5332-41

 [2] Serres MH., Gopal S., Nahum LA., Liang P., Gaasterland T., Riley M., 2001, A functional update of the Escherichia coli K-12 genome., Genome Biol 2(9):RESEARCH0035

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB