RegulonDB RegulonDB 10.9: Gene Form
   

ygfK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygfK ssnA mocA ssnAp ssnAp ygfKp ygfKp yqeCp5 yqeCp5 yqeCp7 yqeCp7

Gene      
Name: ygfK    Texpresso search in the literature
Synonym(s): ECK2874, G7497, b2878
Genome position(nucleotides): 3016060 --> 3019158 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.21
External database links:  
ASAP:
ABE-0009450
ECHOBASE:
EB2873
ECOLIHUB:
ygfK
OU-MICROARRAY:
b2878
STRING:
511145.b2878
COLOMBOS: ygfK


Product      
Name: putative oxidoreductase, Fe-S subunit
Synonym(s): YgfK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 115.581
Isoelectric point: 5.753
Motif(s):
 
Type Positions Sequence
928 -> 958 RFQTLHLDAYCNECGNCAQFCPWNGKPYKDK
453 -> 532 TDCYVAPCVTACAIKQDIPEYIRLLGEHRYADALELIYQRNALPAITGHICDHQCQYNCTRLDYDSALNIRELKKVALEK
552 -> 840 PVAVIGAGPAGLAAGYFLARAGHPVTLFEREANAGGVVKNIIPQFRIPAELIQHDIDFVAAHGVKFEYGCSPDLTIEQLKNQGFHYVLIATGTDKNSGVKLAGDNQNVWKSLPFLREYNKGTALKLGKHVVVVGAGNTAMDCARAALRVPGVEKATIVYRRSLQEMPAWREEYEEALHDGVEFRFLNNPERFDADGTLTLRVMSLGEPDEKGRRRPVETNETVTLLVDSLITAIGEQQDTEALNAMGVPLDKNGWPDVDHNGETRLTDVFMIGDVQRGPSSIVAAVGTA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0015930 - glutamate synthase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0005506 - iron ion binding
biological_process GO:0006537 - glutamate biosynthetic process
GO:0019676 - ammonia assimilation cycle
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-28091N
ECOCYC:
G7497-MONOMER
ECOLIWIKI:
b2878
INTERPRO:
IPR028261
INTERPRO:
IPR023753
INTERPRO:
IPR017900
INTERPRO:
IPR036188
INTERPRO:
IPR009051
INTERPRO:
IPR017701
INTERPRO:
IPR017896
MODBASE:
Q46811
PFAM:
PF14691
PFAM:
PF07992
PRIDE:
Q46811
PROSITE:
PS51379
PROSITE:
PS00198
REFSEQ:
NP_417354
SMR:
Q46811
UNIPROT:
Q46811


Operon      
Name: ygfK-ssnA         
Operon arrangement:
Transcription unit        Promoter
ygfK-ssnA
ssnA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqeCp7 3015167 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqeCp5 3015234 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB