RegulonDB RegulonDB 10.9: Gene Form
   

yghF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yghF yghE yghG yqhJ yghFp yghFp yghDp4 yghDp4 yghDp3 yghDp3

Gene      
Name: yghF    Texpresso search in the literature
Synonym(s): ECK2965, G7537, b2970, ecfA
Genome position(nucleotides): 3112054 <-- 3113049 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.2
External database links:  
ASAP:
ABE-0009745
ECHOBASE:
EB2814
ECOLIHUB:
yghF
OU-MICROARRAY:
b2970
STRING:
316407.85675778
COLOMBOS: yghF


Product      
Name: putative type II secretion system C-type protein YghF
Synonym(s): EcfA, YghF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 37.349
Isoelectric point: 10.335
Motif(s):
 
Type Positions Sequence
44 -> 60 MFWLMLLIISAKMAHSL
46 -> 185 WLMLLIISAKMAHSLWRYISFSAEYTAVSQPVNKPSRVDAKTFDKNDVQLISQQNWFGKYQPVAAQVKQPEPVPVAETRLNVVLRGIAFGARPGAVIEEGGKQQVYLQGETLGSHNAVIEEINRDHVMLRYQGKIERLSL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0015627 - type II protein secretion system complex
biological_process GO:0015031 - protein transport
GO:0015628 - protein secretion by the type II secretion system
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-12204N
ECOCYC:
G7537-MONOMER
ECOLIWIKI:
b2970
INTERPRO:
IPR001639
INTERPRO:
IPR024961
INTERPRO:
IPR036034
PFAM:
PF11356
PRIDE:
Q46834
PROSITE:
PS01141
REFSEQ:
NP_417444
SMR:
Q46834
UNIPROT:
Q46834


Operon      
Name: yghF         
Operon arrangement:
Transcription unit        Promoter
yghF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yghDp3 3111276 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yghDp4 3111307 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB