RegulonDB RegulonDB 10.6.3: Gene Form
   

yqhG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqhG dkgA yqhH RcsB terminator yqhHp4 yqhHp4 yqhGp yqhGp

Gene      
Name: yqhG    Texpresso search in the literature
Synonym(s): ECK3005, G7566, b3013, yqhF
Genome position(nucleotides): 3157650 --> 3158576 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.36
External database links:  
ASAP:
ABE-0009895
ECHOBASE:
EB2836
ECOCYC:
G7566
ECOLIHUB:
yqhG
OU-MICROARRAY:
b3013
REGULONDB:
b3013
STRING:
511145.b3013
M3D: yqhG
COLOMBOS: yqhG
PortEco: b3013


Product      
Name: DUF3828 domain-containing protein YqhG
Synonym(s): YqhF, YqhG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 34.983
Isoelectric point: 4.622
Motif(s):
 
Type Positions Sequence
19 -> 308 QPPSQTVEQTVRHIYQNYKSDATAPYFGETGERAITSARIQQALTLNDNLTLPGNIGWLDYDPVCDCQDFGDLVLESVAITQTDADHADAVVRFRIFKDDKEKTTQTLKMVAENGRWVIDDIVSNHGSVLQAVNSENEKTLAALASLQKEQPEAFVAELFEHIADYSWPWTWVVSDSYRQAVNAFYKTTFKTANNPDEDMQIERQFIYDNPICFGEESLFSRVDEIRVLEKTADSARIHVRFTLTNGNNEEQELVLQRREGKWEIADFIRPNSGSLLKQIEAKTAARLKQ
197 -> 197 R
25 -> 143 VEQTVRHIYQNYKSDATAPYFGETGERAITSARIQQALTLNDNLTLPGNIGWLDYDPVCDCQDFGDLVLESVAITQTDADHADAVVRFRIFKDDKEKTTQTLKMVAENGRWVIDDIVSN
1 -> 18 MKIILLFLAALASFTVHA
240 -> 286 RVDEIRVLEKTADSARIHVRFTLTNGNNEEQELVLQRREGKWEIADF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7566-MONOMER
ECOLIWIKI:
b3013
INTERPRO:
IPR024289
PFAM:
PF12883
PRIDE:
Q46858
PROTEINMODELPORTAL:
Q46858
REFSEQ:
YP_026195
SMR:
Q46858
UNIPROT:
Q46858


Operon      
Name: yqhG         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqhHp4 3158421 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB