RegulonDB RegulonDB 10.9: Gene Form
   

mqsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygiS mqsA mqsR anti-terminator terminator mqsAp2 mqsAp2 mqsAp9 mqsAp9 mqsAp1 mqsAp1 TSS_3325 TSS_3325 ygiSp4 ygiSp4

Gene      
Name: mqsA    Texpresso search in the literature
Synonym(s): ECK3012, G7571, b3021, ygiT
Genome position(nucleotides): 3167851 <-- 3168246 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.17
External database links:  
ASAP:
ABE-0009923
ECHOBASE:
EB2840
ECOLIHUB:
mqsA
OU-MICROARRAY:
b3021
STRING:
511145.b3021
COLOMBOS: mqsA


Product      
Name: antitoxin of the MqsRA toxin-antitoxin system / DNA-binding transcriptional repressor MqsA
Synonym(s): MqsA, YgiT
Sequence: Get amino acid sequence Fasta Format
Regulator Family: CxxCG_CxxCG_HTH, MqsR
Cellular location: cytosol
Molecular weight: 14.703
Isoelectric point: 9.268
Motif(s):
 
Type Positions Sequence
97 -> 97 N
61 -> 61 R
74 -> 127 IVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELL
101 -> 101 R
1 -> 131 MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0043565 - sequence-specific DNA binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[APPHINH] Assay of protein purified to homogeneity from its native host
Reference(s): [1] Kim Y., et al., 2010
[2] Perez-Rueda E., et al., 2004
[3] Yamaguchi Y., et al., 2009
External database links:  
DIP:
DIP-12226N
ECOCYC:
G7571-MONOMER
ECOLIWIKI:
b3021
INTERPRO:
IPR022453
INTERPRO:
IPR032758
INTERPRO:
IPR022452
INTERPRO:
IPR010982
INTERPRO:
IPR001387
PDB:
3GN5
PDB:
3GA8
PDB:
3FMY
PDB:
2KZ8
PDB:
3HI2
PDB:
3O9X
PFAM:
PF15731
PRIDE:
Q46864
PROSITE:
PS50943
REFSEQ:
NP_417493
SMART:
SM00530
SMR:
Q46864
UNIPROT:
Q46864


Operon      
Name: mqsRA         
Operon arrangement:
Transcription unit        Promoter
mqsA
mqsA
mqsRA
mqsRA


Transcriptional Regulation      
Display Regulation             
Repressed by: MqsA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygiSp4 3167731 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_3325 3167746 reverse nd [RS-EPT-CBR] [5]
  promoter mqsAp9 3168371 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kim Y., Wang X., Zhang XS., Grigoriu S., Page R., Peti W., Wood TK., 2010, Escherichia coli toxin/antitoxin pair MqsR/MqsA regulate toxin CspD., Environ Microbiol 12(5):1105-21

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Yamaguchi Y., Park JH., Inouye M., 2009, MqsR, a crucial regulator for quorum sensing and biofilm formation, is a GCU-specific mRNA interferase in Escherichia coli., J Biol Chem 284(42):28746-53

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB