RegulonDB RegulonDB 10.6.3: Gene Form
   

qseB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

qseC qseB ygiW ygiZ QseB BasR QseB ygiWp5 ygiWp5 qseBp1 qseBp1 ygiWp6 ygiWp6 qseBp2 qseBp2 ygiWp7 ygiWp7 TSS_3326 (cluster) TSS_3326 (cluster) ygiVp3 ygiVp3 ygiVp2 ygiVp2

Gene      
Name: qseB    Texpresso search in the literature
Synonym(s): ECK3016, G7575, b3025, ygiX
Genome position(nucleotides): 3169828 --> 3170487 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.67
External database links:  
ASAP:
ABE-0009936
ECHOBASE:
EB2844
ECOCYC:
G7575
ECOLIHUB:
qseB
OU-MICROARRAY:
b3025
REGULONDB:
b3025
STRING:
511145.b3025
M3D: qseB
COLOMBOS: qseB
PortEco: b3025


Product      
Name: DNA-binding transcriptional activator QseB
Synonym(s): QseB, QseB response regulator, YgiX
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 24.678
Isoelectric point: 7.073
Motif(s):
 
Type Positions Sequence
2 -> 116 RILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGQREPVLILTARDALAERVEGLRLGADDYLCKPFALIEVAARLEALM
3 -> 112 ILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGQREPVLILTARDALAERVEGLRLGADDYLCKPFALIEVAARL
124 -> 218 SNELRHGNVMLDPGKRIATLAGEPLTLKPKEFALLELLMRNAGRVLSRKLIEEKLYTWDEEVTSNAVEVHVHHLRRKLGSDFIRTVHGIGYTLGE
145 -> 216 GEPLTLKPKEFALLELLMRNAGRVLSRKLIEEKLYTWDEEVTSNAVEVHVHHLRRKLGSDFIRTVHGIGYTL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0010038 - response to metal ion
GO:0000160 - phosphorelay signal transduction system
Evidence: [IE] Inferred from experiment
Reference(s): [1] Sperandio V., et al., 2002
External database links:  
ECOCYC:
G7575-MONOMER
ECOLIWIKI:
b3025
INTERPRO:
IPR036388
INTERPRO:
IPR039420
INTERPRO:
IPR011006
INTERPRO:
IPR001867
INTERPRO:
IPR001789
MODBASE:
P52076
PANTHER:
PTHR26402
PFAM:
PF00072
PFAM:
PF00486
PRIDE:
P52076
PRODB:
PRO_000023666
PROSITE:
PS51755
PROSITE:
PS50110
PROTEINMODELPORTAL:
P52076
REFSEQ:
NP_417497
SMART:
SM00448
SMART:
SM00862
SMR:
P52076
UNIPROT:
P52076


Operon      
Name: qseBC         
Operon arrangement:
Transcription unit        Promoter
qseBC
qseBC


Transcriptional Regulation      
Display Regulation             
Activated by: BasR, QseB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygiVp2 3169287 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ygiVp3 3169291 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_3326 (cluster) 3169416 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter ygiWp7 3169688 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ygiWp6 3169749 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ygiWp5 3169887 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sperandio V., Torres AG., Kaper JB., 2002, Quorum sensing Escherichia coli regulators B and C (QseBC): a novel two-component regulatory system involved in the regulation of flagella and motility by quorum sensing in E. coli., Mol Microbiol 43(3):809-21

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB