RegulonDB RegulonDB 10.6.3: Gene Form
   

ygiZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

qseC mdaB ygiZ qseB RcsB ygiNp2 ygiNp2 mdaBp5 mdaBp5 TSS_3327 TSS_3327 mdaBp1 mdaBp1 mdaBp7 mdaBp7 ygiZp ygiZp ygiZp3 ygiZp3

Gene      
Name: ygiZ    Texpresso search in the literature
Synonym(s): ECK3018, G7577, b3027
Genome position(nucleotides): 3171879 <-- 3172211 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
34.23
External database links:  
ASAP:
ABE-0009940
ECHOBASE:
EB2846
ECOCYC:
G7577
ECOLIHUB:
ygiZ
OU-MICROARRAY:
b3027
REGULONDB:
b3027
STRING:
511145.b3027
M3D: ygiZ
COLOMBOS: ygiZ
PortEco: b3027


Product      
Name: DUF2645 domain-containing inner membrane protein YgiZ
Synonym(s): YgiZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 13.201
Isoelectric point: 7.892
Motif(s):
 
Type Positions Sequence
84 -> 104 FWVYVFSLGICLVCGWWLFWG
9 -> 29 IFEALLYIMLTYWLIDSFFAF
13 -> 109 LLYIMLTYWLIDSFFAFNKYDWMLESGGNICSIPSVSGEDRILQAMIAAFFLLTPLIILILRKLFMREMFEFWVYVFSLGICLVCGWWLFWGRFIFC
54 -> 74 ILQAMIAAFFLLTPLIILILR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7577-MONOMER
ECOLIWIKI:
b3027
INTERPRO:
IPR022553
PFAM:
PF10840
PRIDE:
Q46867
PROTEINMODELPORTAL:
Q46867
REFSEQ:
NP_417499
UNIPROT:
Q46867


Operon      
Name: ygiZ         
Operon arrangement:
Transcription unit        Promoter
ygiZ


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygiZp3 3172253 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mdaBp7 3172407 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mdaBp1 3172423 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3327 3172504 forward nd [RS-EPT-CBR] [2]
  promoter mdaBp5 3172506 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygiNp2 3173078 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB