RegulonDB RegulonDB 11.0: Gene Form
   

nfeF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nfeF nfeR ileX NfeR Fur Fur Fur NfeR nfeRp nfeRp yqjHp4 yqjHp4 yqjHp yqjHp yqjHp5 yqjHp5

Gene      
Name: nfeF    Texpresso search in the literature
Synonym(s): ECK3060, G7593, b3070, yqjH
Genome position(nucleotides): 3215727 <-- 3216491
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.34
External database links:  
ASAP:
ABE-0010079
ECHOBASE:
EB2787
ECOLIHUB:
yqjH
OU-MICROARRAY:
b3070
STRING:
511145.b3070
COLOMBOS: nfeF


Product      
Name: NADPH-dependent ferric-chelate reductase
Synonym(s): NfeF, Ni-responsive Fe-uptake flavoprotein, YqjH, ferric reductase, NADPH-dependent
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.872
Isoelectric point: 5.626
Motif(s):
 
Type Positions Sequence Comment
15 -> 136 LRFRELTVLRVERISAGFQRIVLGGEALDGFTSRGFDDHSKLFFPQPDAHFVPPTVTEEGIVWPEGPRPPSRDYTPLYDELRHELAIDFFIHDGGVASGWAMQAQPGDKLTVAGPRGSLVVP UniProt: FAD-binding FR-type.
22 -> 132 VLRVERISAGFQRIVLGGEALDGFTSRGFDDHSKLFFPQPDAHFVPPTVTEEGIVWPEGPRPPSRDYTPLYDELRHELAIDFFIHDGGVASGWAMQAQPGDKLTVAGPRGS
141 -> 253 YQLYVCDESGMPALRRRLETLSKLAVKPQVSALVSVRDNACQDYLAHLDGFNIEWLAHDEQAVDARLAQMQIPADDYFIWITGEGKVVKNLSRRFEAEQYDPQRVRAAAYWHA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0071949 - FAD binding
GO:0052851 - ferric-chelate reductase (NADPH) activity
biological_process GO:0015891 - siderophore transport
GO:0010106 - cellular response to iron ion starvation
GO:0033212 - iron import into cell
GO:0033214 - siderophore-dependent iron import into cell
GO:0071289 - cellular response to nickel ion
Note(s): Note(s): ...[more].
Reference(s): [1] Wang S., et al., 2014
External database links:  
ALPHAFOLD:
Q46871
ECOCYC:
G7593-MONOMER
ECOLIWIKI:
b3070
INTERPRO:
IPR013113
INTERPRO:
IPR007037
INTERPRO:
IPR017938
INTERPRO:
IPR039374
INTERPRO:
IPR039261
INTERPRO:
IPR017927
MODBASE:
Q46871
PANTHER:
PTHR30157
PFAM:
PF04954
PFAM:
PF08021
PRIDE:
Q46871
PROSITE:
PS51384
REFSEQ:
NP_417541
SMR:
Q46871
UNIPROT:
Q46871


Operon      
Name: nfeF         
Operon arrangement:
Transcription unit        Promoter
nfeF


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur, NfeR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqjHp5 3216536 reverse nd [ICWHO] [2]
  promoter yqjHp4 3216539 reverse nd [ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Wang S., Blahut M., Wu Y., Philipkosky KE., Outten FW., 2014, Communication between binding sites is required for YqjI regulation of target promoters within the yqjH-yqjI intergenic region., J Bacteriol 196(17):3199-207

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB