RegulonDB RegulonDB 11.0: Gene Form
   

nfeR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aer nfeF nfeR NtrC NfeR Fur Fur Fur NfeR nfeRp nfeRp yqjHp4 yqjHp4 yqjHp yqjHp yqjHp5 yqjHp5

Gene      
Name: nfeR    Texpresso search in the literature
Synonym(s): ECK3061, G7594, b3071, yqjI
Genome position(nucleotides): 3216779 --> 3217402
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.69
External database links:  
ASAP:
ABE-0010084
ECHOBASE:
EB2788
ECOLIHUB:
yqjI
OU-MICROARRAY:
b3071
STRING:
511145.b3071
COLOMBOS: nfeR


Product      
Name: DNA-binding transcriptional repressor NfeR
Synonym(s): NfeR, YqjI
Sequence: Get amino acid sequence Fasta Format
Regulator Family: PadR
Cellular location: cytosol
Molecular weight: 23.401
Isoelectric point: 6.737
Motif(s):
 
Type Positions Sequence Comment
1 -> 46 MSHHHEGCCKHEGQPRHEGCCKGEKSEHEHCGHGHQHEHGQCCGGR UniProt: Disordered; Sequence Annotation Type: region of interest.
67 -> 136 ILDILSRDDSHGYELIKAIENLTQGNYTPSPGVIYPTLDFLQEQSLITIREEEGGKKQIALTEQGAQWLE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P64588
DIP:
DIP-48127N
ECOCYC:
G7594-MONOMER
ECOLIWIKI:
b3071
INTERPRO:
IPR005149
INTERPRO:
IPR036390
INTERPRO:
IPR036388
PFAM:
PF03551
PRIDE:
P64588
REFSEQ:
NP_417542
SMR:
P64588
UNIPROT:
P64588


Operon      
Name: nfeR         
Operon arrangement:
Transcription unit        Promoter
nfeR


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: NfeR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqjHp5 3216536 reverse nd [ICWHO] [1]
  promoter yqjHp4 3216539 reverse nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB