RegulonDB RegulonDB 10.6.3: Gene Form
   

higA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadH rlmG higA higB HigA HigA anti-anti-terminator higBp higBp higAp8 higAp8

Gene      
Name: higA    Texpresso search in the literature
Synonym(s): ECK3072, G7601, b3082, ygjM
Genome position(nucleotides): 3233728 <-- 3234144 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.44
External database links:  
ASAP:
ABE-0010126
ECHOBASE:
EB2583
ECOCYC:
G7601
ECOLIHUB:
higA
OU-MICROARRAY:
b3082
REGULONDB:
b3082
STRING:
511145.b3082
M3D: higA
COLOMBOS: higA
PortEco: b3082


Product      
Name: antitoxin/DNA-binding transcriptional repressor HigA
Synonym(s): HigA, HigA antitoxin of the HigB-HigA toxin-antitoxin system, YgjM
Sequence: Get amino acid sequence Fasta Format
Regulator Family: SinR
Cellular location: cytosol
Molecular weight: 14.995
Isoelectric point: 4.457
Motif(s):
 
Type Positions Sequence
84 -> 136 IRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALF
95 -> 114 LSDLPEIGSKSMVSRVLSGK

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
External database links:  
ECOCYC:
G7601-MONOMER
ECOLIWIKI:
b3082
INTERPRO:
IPR039060
INTERPRO:
IPR001387
INTERPRO:
IPR010982
PANTHER:
PTHR40455
PDB:
5IFG
PFAM:
PF01381
PRIDE:
P67701
PROSITE:
PS50943
PROTEINMODELPORTAL:
P67701
REFSEQ:
NP_417553
SMART:
SM00530
SMR:
P67701
UNIPROT:
P67701


Operon      
Name: higBA         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Repressed by: HigA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter higAp8 3234341 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB