RegulonDB RegulonDB 10.8: Gene Form
   

ygjP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmG ygjQ ygjP terminator anti-terminator anti-anti-terminator ygjQp5 ygjQp5 ygjQp6 ygjQp6 ygjQp3 ygjQp3 ygjQp4 ygjQp4 rlmGp4 rlmGp4

Gene      
Name: ygjP    Texpresso search in the literature
Synonym(s): ECK3075, G7604, b3085
Genome position(nucleotides): 3235960 --> 3236463 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.79
External database links:  
ASAP:
ABE-0010138
ECHOBASE:
EB2586
OU-MICROARRAY:
b3085
PortEco:
ygjP
STRING:
511145.b3085
COLOMBOS: ygjP


Product      
Name: putative metal-dependent hydrolase
Synonym(s): YgjP
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 19.483
Isoelectric point: 9.838
Motif(s):
 
Type Positions Sequence
95 -> 149 LKAKVEIRVATVFRNAPEPFLRMIVVHELAHLKEKEHNKAFYQLCCHMEPQYHQL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016787 - hydrolase activity
GO:0000166 - nucleotide binding
biological_process GO:0009117 - nucleotide metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7604-MONOMER
ECOLIWIKI:
b3085
INTERPRO:
IPR002725
PFAM:
PF01863
PRIDE:
P42597
REFSEQ:
NP_417556
SMR:
P42597
UNIPROT:
P42597


Operon      
Name: ygjP         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rlmGp4 3235892 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygjQp4 3236365 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygjQp3 3236399 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygjQp6 3236462 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ygjQp5 3236513 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB