RegulonDB RegulonDB 10.9: Gene Form
   

yqjA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqjA mzrA yqiM TSS_3400 (cluster) TSS_3400 (cluster) TSS_3399 (cluster) TSS_3399 (cluster) TSS_3398 TSS_3398 TSS_3397 TSS_3397 TSS_3396 TSS_3396 TSS_3395 TSS_3395 TSS_3394 TSS_3394 TSS_3393 TSS_3393

Gene      
Name: yqjA    Texpresso search in the literature
Synonym(s): ECK3086, G7609, b3095, ecfL
Genome position(nucleotides): 3247773 --> 3248435 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.68
External database links:  
ASAP:
ABE-0010181
ECHOBASE:
EB2596
ECOLIHUB:
yqjA
OU-MICROARRAY:
b3095
STRING:
511145.b3095
COLOMBOS: yqjA


Product      
Name: DedA family protein YqjA
Synonym(s): EcfL, YqjA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.585
Isoelectric point: 9.999
Motif(s):
 
Type Positions Sequence
192 -> 212 LMLLPVVLLVFGLAGSLVVLW
28 -> 48 LYFVLFVILFLENGLLPAAFL
51 -> 51 D
48 -> 173 LPGDSLLVLVGVLIAKGAMGYPQTILLLTVAASLGCWVSYIQGRWLGNTRTVQNWLSHLPAHYHQRAHHLFHKHGLSALLIGRFIAFVRTLLPTIAGLSGLNNARFQFFNWMSGLLWVLILTTLGY
74 -> 94 LLTVAASLGCWVSYIQGRWLG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0042493 - response to drug
GO:0043093 - FtsZ-dependent cytokinesis
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Kumar A., et al., 2016
[2] Kumar S., et al., 2014
External database links:  
ECOCYC:
G7609-MONOMER
ECOLIWIKI:
b3095
INTERPRO:
IPR032816
INTERPRO:
IPR032818
PANTHER:
PTHR30353
PFAM:
PF09335
PRIDE:
P0AA63
REFSEQ:
NP_417566
UNIPROT:
P0AA63


Operon      
Name: yqjA-mzrA         
Operon arrangement:
Transcription unit        Promoter
yqjA-mzrA
yqjA-mzrA


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3393 3247928 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3394 3248132 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3395 3248267 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3396 3248277 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3397 3248288 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3398 3248312 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3399 (cluster) 3248314 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3400 (cluster) 3248319 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kumar A., Beloglazova N., Bundalovic-Torma C., Phanse S., Deineko V., Gagarinova A., Musso G., Vlasblom J., Lemak S., Hooshyar M., Minic Z., Wagih O., Mosca R., Aloy P., Golshani A., Parkinson J., Emili A., Yakunin AF., Babu M., 2016, Conditional Epistatic Interaction Maps Reveal Global Functional Rewiring of Genome Integrity Pathways in Escherichia coli., Cell Rep 14(3):648-61

 [2] Kumar S., Doerrler WT., 2014, Members of the conserved DedA family are likely membrane transporters and are required for drug resistance in Escherichia coli., Antimicrob Agents Chemother 58(2):923-30

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB