RegulonDB RegulonDB 10.9: Gene Form
   

mzrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: mzrA    Texpresso search in the literature
Synonym(s): ECK3087, G7610, b3096, ecfM, yqjB
Genome position(nucleotides): 3248439 --> 3248822 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.91
External database links:  
ASAP:
ABE-0010183
ECHOBASE:
EB2597
ECOLIHUB:
mzrA
OU-MICROARRAY:
b3096
STRING:
511145.b3096
COLOMBOS: mzrA


Product      
Name: modulator protein MzrA
Synonym(s): EcfM, MzrA, YqjB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 14.172
Isoelectric point: 10.101
Motif(s):
 
Type Positions Sequence
51 -> 51 D
67 -> 67 K
78 -> 78 I
11 -> 31 LAWSGAVLLLVGTLLLAWSAV
17 -> 104 VLLLVGTLLLAWSAVRQQESTLAIRAVHQGTTMPDGFSIWHHLDAHGIPFKSITPKNDTLLITFDSSDQSAAAKAVLDRTLPHGYIIA

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0019901 - protein kinase binding
biological_process GO:0045859 - regulation of protein kinase activity
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
Reference(s): [1] Gerken H., et al., 2009
External database links:  
ECOCYC:
G7610-MONOMER
ECOLIWIKI:
b3096
INTERPRO:
IPR027398
INTERPRO:
IPR026574
PFAM:
PF13721
PRIDE:
P42615
REFSEQ:
NP_417567
SMR:
P42615
UNIPROT:
P42615


Operon      
Name: yqjA-mzrA         
Operon arrangement:
Transcription unit        Promoter
yqjA-mzrA
yqjA-mzrA


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3393 3247928 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3394 3248132 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3395 3248267 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3396 3248277 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3397 3248288 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3398 3248312 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3399 (cluster) 3248314 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3400 (cluster) 3248319 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3401 3248969 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3402 (cluster) 3249228 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3403 (cluster) 3249266 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3404 3249284 forward nd [RS-EPT-CBR] [2]



RegulonDB