RegulonDB RegulonDB 10.8: Gene Form
   

yqjE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqjE yqjF yqjD yqjK yqjFp4 yqjFp4 yqjFp3 yqjFp3 yqjFp2 yqjFp2

Gene      
Name: yqjE    Texpresso search in the literature
Synonym(s): ECK3090, G7613, b3099
Genome position(nucleotides): 3249683 --> 3250087 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.84
External database links:  
ASAP:
ABE-0010195
ECHOBASE:
EB2600
OU-MICROARRAY:
b3099
PortEco:
yqjE
STRING:
511145.b3099
COLOMBOS: yqjE


Product      
Name: inner membrane protein YqjE
Synonym(s): YqjE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 15.147
Isoelectric point: 7.863
Motif(s):
 
Type Positions Sequence
84 -> 104 AMIATTVVLLLLALIGGIWTL
56 -> 76 LTMLFAAFGLMSLMVLIIWAV
19 -> 127 QRIVSIMVEMVETRLRLAVVELEEEKANLFQLLLMLGLTMLFAAFGLMSLMVLIIWAVDPQYRLNAMIATTVVLLLLALIGGIWTLRKSRKSTLLRHTRHELANDRQLL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7613-MONOMER
ECOLIWIKI:
b3099
INTERPRO:
IPR009937
PFAM:
PF07332
PRIDE:
P64585
REFSEQ:
NP_417570
UNIPROT:
P64585


Operon      
Name: yqjCDEK         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqjFp2 3250466 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqjFp3 3250472 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqjFp4 3250475 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB