RegulonDB RegulonDB 10.8: Gene Form
   

yqjK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqjE yqjF yqjD yqjK yqjFp4 yqjFp4 yqjFp3 yqjFp3 yqjFp2 yqjFp2

Gene      
Name: yqjK    Texpresso search in the literature
Synonym(s): ECK3091, G7614, b3100
Genome position(nucleotides): 3250077 --> 3250376 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.67
External database links:  
ASAP:
ABE-0010197
ECHOBASE:
EB4061
OU-MICROARRAY:
b3100
PortEco:
yqjK
STRING:
511145.b3100
COLOMBOS: yqjK


Product      
Name: PF13997 family protein YqjK
Synonym(s): YqjK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.811
Isoelectric point: 12.457
Motif(s):
 
Type Positions Sequence
14 -> 86 LLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7614-MONOMER
ECOLIWIKI:
b3100
INTERPRO:
IPR025612
PFAM:
PF13997
PRIDE:
Q47710
REFSEQ:
NP_417571
UNIPROT:
Q47710


Operon      
Name: yqjCDEK         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqjFp2 3250466 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqjFp3 3250472 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqjFp4 3250475 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB