RegulonDB RegulonDB 10.8: Gene Form
   

yqjG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqjG yqjF yhaH terminator yhaHp8 yhaHp8 yhaHp7 yhaHp7 yqjGp2 yqjGp2

Gene      
Name: yqjG    Texpresso search in the literature
Synonym(s): ECK3093, G7616, b3102
Genome position(nucleotides): 3251024 --> 3252010 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.17
External database links:  
ASAP:
ABE-0010203
ECHOBASE:
EB2602
OU-MICROARRAY:
b3102
PortEco:
yqjG
STRING:
511145.b3102
COLOMBOS: yqjG


Product      
Name: glutathionyl-hydroquinone reductase YqjG
Synonym(s): S-glutathionyl-(chloro)hydroquinone reductase, YqjG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.386
Isoelectric point: 6.453
Motif(s):
 
Type Positions Sequence
63 -> 63 C
148 -> 149 ES
62 -> 158 ACPWAHRTLIMRKLKGLEPFISVSVVNPLMLENGWTFDDSFPGATGDTLYQNEFLYQLYLHADPHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNT
130 -> 133 RVTV
203 -> 257 QEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRLWTTLVRFDPVYVTHF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0004364 - glutathione transferase activity
GO:0042803 - protein homodimerization activity
GO:0016672 - oxidoreductase activity, acting on a sulfur group of donors, quinone or similar compound as acceptor
biological_process GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-12888N
ECOCYC:
G7616-MONOMER
ECOLIWIKI:
b3102
INTERPRO:
IPR040079
INTERPRO:
IPR036282
INTERPRO:
IPR036249
INTERPRO:
IPR016639
INTERPRO:
IPR010987
INTERPRO:
IPR004045
MODBASE:
P42620
PANTHER:
PTHR32419
PDB:
4G0L
PDB:
4G0K
PDB:
4G0I
PDB:
3R3E
PFAM:
PF13409
PRIDE:
P42620
PROSITE:
PS50405
REFSEQ:
NP_417573
SMR:
P42620
UNIPROT:
P42620


Operon      
Name: yqjG         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqjGp2 3250974 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhaHp7 3252249 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhaHp8 3252263 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB