RegulonDB RegulonDB 10.8: Gene Form
   

yhaH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqjG yhaH yhaI yhaIp12 yhaIp12 yhaIp11 yhaIp11 yhaIp10 yhaIp10 yhaIp9 yhaIp9 yhaHp8 yhaHp8 yhaHp7 yhaHp7

Gene      
Name: yhaH    Texpresso search in the literature
Synonym(s): ECK3094, G7617, b3103
Genome position(nucleotides): 3252304 --> 3252669 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.91
External database links:  
ASAP:
ABE-0010207
ECHOBASE:
EB2603
OU-MICROARRAY:
b3103
PortEco:
yhaH
STRING:
511145.b3103
COLOMBOS: yhaH


Product      
Name: putative inner membrane protein
Synonym(s): YhaH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 14.281
Isoelectric point: 10.145
Motif(s):
 
Type Positions Sequence
81 -> 101 SAWWALLFLIPFIGWLIIIVF
11 -> 117 YVGFRGRARRKEYWMFILVNIIFTFVLGLLDKMLGWQRAGGEGILTTIYGILVFLPWWAVQFRRLHDTDRSAWWALLFLIPFIGWLIIIVFNCQAGTPGENRFGPDP
50 -> 70 GGEGILTTIYGILVFLPWWAV
24 -> 44 WMFILVNIIFTFVLGLLDKML

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7617-MONOMER
ECOLIWIKI:
b3103
INTERPRO:
IPR008523
PANTHER:
PTHR34980
PFAM:
PF05656
PRIDE:
P64590
REFSEQ:
NP_417574
UNIPROT:
P64590


Operon      
Name: yhaH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhaHp7 3252249 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhaHp8 3252263 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter yhaIp9 3252700 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhaIp10 3252761 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhaIp11 3252783 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhaIp12 3252825 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB