RegulonDB RegulonDB 10.8: Gene Form
   

yhaI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhaJ yhaH yhaI yhaIp12 yhaIp12 yhaIp11 yhaIp11 yhaIp10 yhaIp10 yhaIp9 yhaIp9

Gene      
Name: yhaI    Texpresso search in the literature
Synonym(s): ECK3095, G7618, b3104
Genome position(nucleotides): 3252911 --> 3253267 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.82
External database links:  
ASAP:
ABE-0010211
ECHOBASE:
EB2604
OU-MICROARRAY:
b3104
PortEco:
yhaI
STRING:
511145.b3104
COLOMBOS: yhaI


Product      
Name: putative inner membrane protein
Synonym(s): YhaI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 13.456
Isoelectric point: 9.75
Motif(s):
 
Type Positions Sequence
11 -> 113 YVGFSGRARRKEYWMFTLINAIVGAIINVIQLILGLELPYLSMLYLLATFLPVLALAIRRLHDTDRSGAWALLFFVPFIGWLVLLVFFCTEGTSGSNRYGNDP
78 -> 98 GAWALLFFVPFIGWLVLLVFF
26 -> 46 FTLINAIVGAIINVIQLILGL
48 -> 68 LPYLSMLYLLATFLPVLALAI

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7618-MONOMER
ECOLIWIKI:
b3104
INTERPRO:
IPR008523
PANTHER:
PTHR34980
PFAM:
PF05656
PRIDE:
P64592
REFSEQ:
NP_417575
SMR:
P64592
UNIPROT:
P64592


Operon      
Name: yhaI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhaIp9 3252700 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhaIp10 3252761 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhaIp11 3252783 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhaIp12 3252825 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB