RegulonDB RegulonDB 10.8: Gene Form
   

yhaK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhaJ yhaK yhaL yhaKp3 yhaKp3 yhaJp4 yhaJp4 yhaKp4 yhaKp4 yhaKp5 yhaKp5 yhaJp7 yhaJp7 TSS_3406 TSS_3406

Gene      
Name: yhaK    Texpresso search in the literature
Synonym(s): ECK3097, G7620, b3106
Genome position(nucleotides): 3254319 --> 3255020 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.42
External database links:  
ASAP:
ABE-0010217
ECHOBASE:
EB2606
OU-MICROARRAY:
b3106
PortEco:
yhaK
STRING:
511145.b3106
COLOMBOS: yhaK


Product      
Name: bicupin-related protein
Synonym(s): YhaK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.895
Isoelectric point: 6.854
Motif(s):
 
Type Positions Sequence
4 -> 119 TRTARQCGQADYGWLQARYTFSFGHYFDPKLLGYASLRVLNQEVLAPGAAFQPRTYPKVDILNVILDGEAEYRDSEGNHVQASAGEALLLSTQPGVSYSEHNLSKDKPLTRMQLWL
142 -> 231 LIASPEGAMGSLQLRQQVWLHHIVLDKGESANFQLHGPRAYLQSIHGKFHALTHHEEKAALTCGDGAFIRDEANITLVADSPLRALLIDL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7620-MONOMER
ECOLIWIKI:
b3106
INTERPRO:
IPR003829
INTERPRO:
IPR041602
INTERPRO:
IPR014710
INTERPRO:
IPR012093
INTERPRO:
IPR011051
MODBASE:
P42624
PANTHER:
PTHR13903
PDB:
2VEC
PFAM:
PF17954
PFAM:
PF02678
PRIDE:
P42624
REFSEQ:
NP_417577
SMR:
P42624
UNIPROT:
P42624


Operon      
Name: yhaKL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3406 3254242 reverse nd [RS-EPT-CBR] [1]
  promoter yhaJp7 3254261 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yhaKp5 3254269 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yhaKp4 3254274 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yhaJp4 3254280 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yhaKp3 3254291 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB