RegulonDB RegulonDB 10.8: Gene Form
   

cyuA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cyuP cyuA yhaL terminator

Gene      
Name: cyuA    Texpresso search in the literature
Synonym(s): ECK3099, G7622, b3108, b3109, b4470, yhaM, yhaN
Genome position(nucleotides): 3255341 <-- 3256651 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.9
External database links:  
ASAP:
ABE-0174100
ECHOBASE:
EB2608
ECOO157CYC:
Z4462
OU-MICROARRAY:
b3108
PortEco:
yhaM
STRING:
511145.b4470
COLOMBOS: cyuA


Product      
Name: putative L-cysteine desulfidase CyuA
Synonym(s): CyuA, YhaM, YhaN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.361
Isoelectric point: 4.991
Motif(s):
 
Type Positions Sequence
175 -> 428 ESPLTVLSRTTLAEILKFVNEVPFAAIRFILDSAKLNCALSQEGLSGKWGLHIGATLEKQCERGLLAKDLSSSIVIRTSAASDARMGGATLPAMSNSGSGNQGITATMPVVVVAEHFGADDERLARALMLSHLSAIYIHNQLPRLSALCAATTAAMGAAAGMAWLVDGRYETISMAISSMIGDVSGMICDGASNSCAMKVSTSASAAWKAVLMALDDTAVTGNEGIVAHDVEQSIANLCALASHSMQQTDRQII

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0080146 - L-cysteine desulfhydrase activity
biological_process GO:0009093 - cysteine catabolic process
GO:1901367 - response to L-cysteine
GO:0019450 - L-cysteine catabolic process to pyruvate
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7622-MONOMER
ECOLIWIKI:
b4470
ECOO157CYC:
Z4462-MONOMER
INTERPRO:
IPR005130
INTERPRO:
IPR021144
PANTHER:
PTHR30501
PFAM:
PF03313
PRIDE:
P42626
REFSEQ:
YP_026202
SMR:
P42626
UNIPROT:
P42626


Operon      
Name: cyuPA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB