RegulonDB RegulonDB 10.7: Gene Form
   

tdcG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tdcG cyuP tdcF terminator tdcGp2 tdcGp2

Gene      
Name: tdcG    Texpresso search in the literature
Synonym(s): ECK3101, G7624, b3111, b3112, b4471, sdhY, tdcGa, yhaP, yhaQ
Genome position(nucleotides): 3258285 <-- 3259649 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.41
External database links:  
ASAP:
ABE-0174101
ECHOBASE:
EB2610
OU-MICROARRAY:
b3112
PORTECO:
tdcG
REGULONDB:
b4471
STRING:
511145.b4471
M3D: tdcG
COLOMBOS: tdcG
PortEco: b3112


Product      
Name: L-serine deaminase III
Synonym(s): L-serine dehydratase 3, SdhY, TdcG, YhaP, YhaQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 48.522
Isoelectric point: 6.097
Motif(s):
 
Type Positions Sequence
3 -> 155 SAFDIFKIGIGPSSSHTVGPMNAGKSFIDRLESSGLLTATSHIVVDLYGSLSLTGKGHATDVAIIMGLAGNSPQDVVIDEIPAFIELVTRSGRLPVASGAHIVDFPVAKNIIFHPEMLPRHENGMRITAWKGQEELLSKTYYSVGGGFIVEEE
184 -> 448 NGLSISGLMMHNELALRSKAEIDAGFARIWQVMHDGIERGMNTEGVLPGPLNVPRRAVALRRQLVSSDNISNDPMNVIDWINMYALAVSEENAAGGRVVTAPTNGACGIIPAVLAYYDKFRRPVNERSIARYFLAAGAIGALYKMNASISGAEVGCQGEIGVACSMAAAGLTELLGGSPAQVCNAAEIAMEHNLGLTCDPVAGQVQIPCIERNAINAVKAVNAARMAMRRTSAPRVSLDKVIETMYETGKDMNDKYRETSRGGLA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
Gene Ontology Terms (GO)  
molecular_function GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0003941 - L-serine ammonia-lyase activity
biological_process GO:0006094 - gluconeogenesis
GO:0009063 - cellular amino acid catabolic process
GO:0070689 - L-threonine catabolic process to propionate
External database links:  
DIP:
DIP-10974N
ECOCYC:
LSERINEDEAM3-MONOMER
ECOLIWIKI:
b4471
INTERPRO:
IPR005131
INTERPRO:
IPR005130
INTERPRO:
IPR004644
INTERPRO:
IPR029009
PFAM:
PF03315
PFAM:
PF03313
PRIDE:
P42630
PRODB:
PRO_000024043
PROTEINMODELPORTAL:
P42630
REFSEQ:
YP_026204
SMR:
P42630
UNIPROT:
P42630


Operon      
Name: tdcABCDEFG         
Operon arrangement:
Transcription unit        Promoter
tdcABCDEFG
tdcBCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, TdcA, TdcR, FNR, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tdcGp2 3259826 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB