RegulonDB RegulonDB 10.7: Gene Form
   

tdcF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tdcE tdcG tdcF tdcGp2 tdcGp2

Gene      
Name: tdcF    Texpresso search in the literature
Synonym(s): ECK3102, G7626, b3113, yhaR
Genome position(nucleotides): 3259721 <-- 3260110 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.56
External database links:  
ASAP:
ABE-0010240
ECHOBASE:
EB2611
OU-MICROARRAY:
b3113
PORTECO:
tdcF
REGULONDB:
b3113
STRING:
511145.b3113
M3D: tdcF
COLOMBOS: tdcF
PortEco: b3113


Product      
Name: putative enamine/imine deaminase
Synonym(s): TdcF, YhaR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.007
Isoelectric point: 4.825
Motif(s):
 
Type Positions Sequence
105 -> 107 RSC
8 -> 126 QRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0019239 - deaminase activity
GO:0042802 - identical protein binding
biological_process GO:0006566 - threonine metabolic process
GO:0070689 - L-threonine catabolic process to propionate
GO:1901565 - organonitrogen compound catabolic process
External database links:  
DIP:
DIP-48213N
ECOCYC:
G7626-MONOMER
ECOLIWIKI:
b3113
INTERPRO:
IPR006056
INTERPRO:
IPR035959
INTERPRO:
IPR019897
INTERPRO:
IPR006175
MODBASE:
P0AGL2
PANTHER:
PTHR11803
PDB:
2UYP
PDB:
2UYN
PDB:
2UYK
PDB:
2UYJ
PFAM:
PF01042
PRIDE:
P0AGL2
PRODB:
PRO_000024042
PROSITE:
PS01094
PROTEINMODELPORTAL:
P0AGL2
REFSEQ:
NP_417583
SMR:
P0AGL2
SWISSMODEL:
P0AGL2
UNIPROT:
P0AGL2


Operon      
Name: tdcABCDEFG         
Operon arrangement:
Transcription unit        Promoter
tdcABCDEFG
tdcBCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: TdcA, CRP, TdcR, FNR, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tdcGp2 3259826 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB