RegulonDB RegulonDB 10.7: Gene Form
   

tdcE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tdcE tdcD tdcF tdcGp2 tdcGp2

Gene      
Name: tdcE    Texpresso search in the literature
Synonym(s): ECK3103, G7627, b3114, yhaS
Genome position(nucleotides): 3260124 <-- 3262418 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.12
External database links:  
ASAP:
ABE-0010242
ECHOBASE:
EB2612
OU-MICROARRAY:
b3114
PORTECO:
tdcE
REGULONDB:
b3114
STRING:
511145.b3114
M3D: tdcE
COLOMBOS: tdcE
PortEco: b3114


Product      
Name: 2-ketobutyrate formate-lyase/pyruvate formate-lyase 4
Synonym(s): TdcE, YhaS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 85.935
Isoelectric point: 5.525
Motif(s):
 
Type Positions Sequence
7 -> 629 TSDKLYADAWLGFKGTDWKNEINVRDFIQHNYTPYEGDESFLAEATPATTELWEKVMEGIRIENATHAPVDFDTNIATTITAHDAGYINQPLEKIVGLQTDAPLKRALHPFGGINMIKSSFHAYGREMDSEFEYLFTDLRKTHNQGVFDVYSPDMLRCRKSGVLTGLPDGYGRGRIIGDYRRVALYGISYLVRERELQFADLQSRLEKGEDLEATIRLREELAEHRHALLQIQEMAAKYGFDISRPAQNAQEAVQWLYFAYLAAVKSQNGGAMSLGRTASFLDIYIERDFKAGVLNEQQAQELIDHFIMKIRMVRFLRTPEFDSLFSGDPIWATEVIGGMGLDGRTLVTKNSFRYLHTLHTMGPAPEPNLTILWSEELPIAFKKYAAQVSIVTSSLQYENDDLMRTDFNSDDYAIACCVSPMVIGKQMQFFGARANLAKTLLYAINGGVDEKLKIQVGPKTAPLMDDVLDYDKVMDSLDHFMDWLAVQYISALNIIHYMHDKYSYEASLMALHDRDVYRTMACGIAGLSVATDSLSAIKYARVKPIRDENGLAVDFEIDGEYPQYGNNDERVDSIACDLVERFMKKIKALPTYRNAVPTQSILTITSNVVYGQKTGNTPDGRR
27 -> 618 EINVRDFIQHNYTPYEGDESFLAEATPATTELWEKVMEGIRIENATHAPVDFDTNIATTITAHDAGYINQPLEKIVGLQTDAPLKRALHPFGGINMIKSSFHAYGREMDSEFEYLFTDLRKTHNQGVFDVYSPDMLRCRKSGVLTGLPDGYGRGRIIGDYRRVALYGISYLVRERELQFADLQSRLEKGEDLEATIRLREELAEHRHALLQIQEMAAKYGFDISRPAQNAQEAVQWLYFAYLAAVKSQNGGAMSLGRTASFLDIYIERDFKAGVLNEQQAQELIDHFIMKIRMVRFLRTPEFDSLFSGDPIWATEVIGGMGLDGRTLVTKNSFRYLHTLHTMGPAPEPNLTILWSEELPIAFKKYAAQVSIVTSSLQYENDDLMRTDFNSDDYAIACCVSPMVIGKQMQFFGARANLAKTLLYAINGGVDEKLKIQVGPKTAPLMDDVLDYDKVMDSLDHFMDWLAVQYISALNIIHYMHDKYSYEASLMALHDRDVYRTMACGIAGLSVATDSLSAIKYARVKPIRDENGLAVDFEIDGEYPQYGNNDERVDSIACDLVERFMKKIKALPTYRNAVPTQSILTITSNVVYG
634 -> 745 FAPGANPMHGRDRKGAVASLTSVAKLPFTYAKDGISYTFSIVPAALGKEDPVRKTNLVGLLDGYFHHEADVEGGQHLNVNVMNREMLLDAIEHPEKYPNLTIRVSGYAVRFN
636 -> 764 PGANPMHGRDRKGAVASLTSVAKLPFTYAKDGISYTFSIVPAALGKEDPVRKTNLVGLLDGYFHHEADVEGGQHLNVNVMNREMLLDAIEHPEKYPNLTIRVSGYAVRFNALTREQQQDVISRTFTQAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.30 - threonine catabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0008861 - formate C-acetyltransferase activity
GO:0043875 - 2-ketobutyrate formate-lyase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006567 - threonine catabolic process
GO:0070689 - L-threonine catabolic process to propionate
External database links:  
DIP:
DIP-10972N
ECOCYC:
KETOBUTFORMLY-INACT-MONOMER
ECOLIWIKI:
b3114
INTERPRO:
IPR004184
INTERPRO:
IPR019777
INTERPRO:
IPR005949
INTERPRO:
IPR001150
MINT:
MINT-1231745
MODBASE:
P42632
PFAM:
PF02901
PFAM:
PF01228
PRIDE:
P42632
PRODB:
PRO_000024041
PROSITE:
PS51554
PROSITE:
PS51149
PROSITE:
PS00850
PROTEINMODELPORTAL:
P42632
REFSEQ:
YP_026205
SMR:
P42632
SWISSMODEL:
P42632
UNIPROT:
P42632


Operon      
Name: tdcABCDEFG         
Operon arrangement:
Transcription unit        Promoter
tdcABCDEFG
tdcBCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, TdcA, TdcR, FNR, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tdcGp2 3259826 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB