RegulonDB RegulonDB 10.9: Gene Form
   

ibaG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

murA mlaB ibaG MlrA terminator ibaGp4 ibaGp4 ibaGp9 ibaGp9 ibaGp2 ibaGp2 ibaGp ibaGp TSS_3501 (cluster) TSS_3501 (cluster) TSS_3500 TSS_3500

Gene      
Name: ibaG    Texpresso search in the literature
Synonym(s): ECK3179, G7657, b3190, yrbA
Genome position(nucleotides): 3336549 <-- 3336803 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.59
External database links:  
ASAP:
ABE-0010481
ECHOBASE:
EB2648
ECOLIHUB:
yrbA
OU-MICROARRAY:
b3190
STRING:
511145.b3190
COLOMBOS: ibaG


Product      
Name: acid stress protein IbaG
Synonym(s): IbaG, YrbA, putative DNA-binding transcriptional regulator IbaG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.452
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
18 -> 74 EVHVSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYIADNRIHAVSIKAYTPAE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
biological_process GO:0097533 - cellular stress response to acid chemical
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Nicolaou SA., et al., 2012
[2] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-48231N
ECOCYC:
G7657-MONOMER
ECOLIWIKI:
b3190
INTERPRO:
IPR002634
INTERPRO:
IPR036065
MODBASE:
P0A9W6
PDB:
1NY8
PFAM:
PF01722
PRIDE:
P0A9W6
REFSEQ:
NP_417657
SMR:
P0A9W6
UNIPROT:
P0A9W6


Operon      
Name: ibaG-murA         
Operon arrangement:
Transcription unit        Promoter
ibaG-murA
ibaG
murA


Transcriptional Regulation      
Display Regulation             
Activated by: MlrA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3500 3336517 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3501 (cluster) 3336555 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter ibaGp9 3336954 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ibaGp4 3336983 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Nicolaou SA., Gaida SM., Papoutsakis ET., 2012, Exploring the combinatorial genomic space in Escherichia coli for ethanol tolerance., Biotechnol J 7(11):1337-45

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB