RegulonDB RegulonDB 10.6.3: Gene Form
   

yrbL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mtgA elbB yrbL npr rapZ SoxR SoxS PhoP BasR terminator mtgAp4 mtgAp4 TSS_3528 (cluster) TSS_3528 (cluster) yrbLp yrbLp TSS_3527 TSS_3527

Gene      
Name: yrbL    Texpresso search in the literature
Synonym(s): ECK3196, G7667, b3207
Genome position(nucleotides): 3348452 --> 3349084 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.18
External database links:  
ASAP:
ABE-0010528
ECHOBASE:
EB2658
ECOCYC:
G7667
ECOLIHUB:
yrbL
OU-MICROARRAY:
b3207
REGULONDB:
b3207
STRING:
511145.b3207
M3D: yrbL
COLOMBOS: yrbL
PortEco: b3207


Product      
Name: protein kinase-like domain-containing protein YrbL
Synonym(s): YrbL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.345
Isoelectric point: 8.887
Motif(s):
 
Type Positions Sequence
2 -> 185 IRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLKRYLQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKRFIAQP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Si HM., et al., 2016
External database links:  
DIP:
DIP-48162N
ECOCYC:
G7667-MONOMER
ECOLIWIKI:
b3207
INTERPRO:
IPR011009
INTERPRO:
IPR019647
MODBASE:
P64610
PFAM:
PF10707
PRIDE:
P64610
PROTEINMODELPORTAL:
P64610
REFSEQ:
NP_417674
SMR:
P64610
UNIPROT:
P64610


Operon      
Name: yrbL         
Operon arrangement:
Transcription unit        Promoter
yrbL


Transcriptional Regulation      
Display Regulation             
Activated by: SoxR, PhoP, SoxS
Repressed by: BasR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3527 3348325 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3528 (cluster) 3348425 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter mtgAp4 3349831 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Si HM., Zhang F., Wu AN., Han RZ., Xu GC., Ni Y., 2016, DNA microarray of global transcription factor mutant reveals membrane-related proteins involved in n-butanol tolerance in Escherichia coli., Biotechnol Biofuels 9:114

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB