RegulonDB RegulonDB 10.9: Gene Form
   

yhcH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhcG nanK nanE yhcH yhcHp2 yhcHp2

Gene      
Name: yhcH    Texpresso search in the literature
Synonym(s): ECK3210, G7675, b3221
Genome position(nucleotides): 3369014 <-- 3369478 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.31
External database links:  
ASAP:
ABE-0010569
ECHOBASE:
EB2665
ECOLIHUB:
yhcH
OU-MICROARRAY:
b3221
STRING:
511145.b3221
COLOMBOS: yhcH


Product      
Name: DUF386 domain-containing protein YhcH
Synonym(s): YhcH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.038
Isoelectric point: 4.698
Motif(s):
 
Type Positions Sequence
1 -> 149 MMMGEVQSLPSAGLHPALQDALTLALAARPQEKAPGRYELQGDNIFMNVMTFNTQSPVEKKAELHEQYIDIQLLLNGEERILFGMAGTARQCEEFHHEDDYQLCSTIDNEQAIILKPGMFAVFMPGEPHKPGCVVGEPGEIKKVVVKVK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7675-MONOMER
ECOLIWIKI:
b3221
INTERPRO:
IPR004375
INTERPRO:
IPR037012
MODBASE:
P45424
PANTHER:
PTHR34986
PFAM:
PF04074
PRIDE:
P45424
REFSEQ:
NP_417688
SMR:
P45424
SWISSMODEL:
P45424
UNIPROT:
P45424


Operon      
Name: nanATEK-yhcH         
Operon arrangement:
Transcription unit        Promoter
nanA
nanATEK-yhcH


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: NanR, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhcHp2 3369562 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB