RegulonDB RegulonDB 10.6.3: Gene Form
   

gspA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gspA gspC gspB gspD Fur SlyA DksA-ppGpp DksA-ppGpp gspAp4 gspAp4 gspCp3 gspCp3 gspCp2 gspCp2 gspAp1 gspAp1 gspAp2 gspAp2 gspAp3 gspAp3 gspCp1 gspCp1

Gene      
Name: gspA    Texpresso search in the literature
Synonym(s): ECK3310, G7701, b3323, yheD
Genome position(nucleotides): 3453929 <-- 3455398 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.98
External database links:  
ASAP:
ABE-0010867
ECHOBASE:
EB2725
ECOCYC:
G7701
ECOLIHUB:
gspA
OU-MICROARRAY:
b3323
REGULONDB:
b3323
STRING:
511145.b3323
M3D: gspA
COLOMBOS: gspA
PortEco: b3323


Product      
Name: Type II secretion system protein GspA
Synonym(s): GspA, YheD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 55.298
Isoelectric point: 8.565
Motif(s):
 
Type Positions Sequence
20 -> 137 RLCYLLGEAGSGKTWLAQQLQKDKHRRVITLSLVVSWQGKAAWIVTDDNAAEQGCRDSAWTRDEMAGQLLHALHRTDSRCPLIIIENAHLNHRRILDDLQRAISLIPDGQFLLIGRPD
26 -> 33 GEAGSGKT
408 -> 461 EEEILWLETMLNRALHISTEPSAEWRPLLVEKIKQFQKSHHLKTDGVVGFSTLV
237 -> 257 MQLAVVMSGTIIALTCGWLLL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7701-MONOMER
ECOLIWIKI:
b3323
INTERPRO:
IPR027417
INTERPRO:
IPR036366
INTERPRO:
IPR036365
INTERPRO:
IPR003593
INTERPRO:
IPR002477
PFAM:
PF13401
PFAM:
PF01471
PRIDE:
P45756
PROTEINMODELPORTAL:
P45756
REFSEQ:
NP_417782
SMR:
P45756
UNIPROT:
P45756


Operon      
Name: gspAB         
Operon arrangement:
Transcription unit        Promoter
null
null
null
gspAB


Transcriptional Regulation      
Display Regulation             
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB