RegulonDB RegulonDB 10.8: Gene Form
   

gspC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gspD gspE gspA gspC gspF Fur SlyA gspAp4 gspAp4 gspCp3 gspCp3 gspCp2 gspCp2 gspAp1 gspAp1 gspAp2 gspAp2 gspAp3 gspAp3 gspCp1 gspCp1

Gene      
Name: gspC    Texpresso search in the literature
Synonym(s): ECK3311, G7702, b3324, yheE
Genome position(nucleotides): 3455578 --> 3456393 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.4
External database links:  
ASAP:
ABE-0010877
ECHOBASE:
EB2726
OU-MICROARRAY:
b3324
PortEco:
gspC
STRING:
511145.b3324
COLOMBOS: gspC


Product      
Name: Type II secretion system protein GspC
Synonym(s): GspC, YheE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 30.038
Isoelectric point: 7.38
Motif(s):
 
Type Positions Sequence
18 -> 38 AINILIIFISIGSIIFNVNYF
77 -> 152 ANPVAVNQETPKLSIALNGIVLTSNDETSFVLINEGSEQKRYSLNEALESAPGTFIRKINKTSVVFETHGHYEKVT

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0015627 - type II protein secretion system complex
biological_process GO:0015031 - protein transport
GO:0015628 - protein secretion by the type II secretion system
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7702-MONOMER
ECOLIWIKI:
b3324
INTERPRO:
IPR036034
INTERPRO:
IPR024961
INTERPRO:
IPR001639
PFAM:
PF11356
PRIDE:
P45757
PROSITE:
PS01141
REFSEQ:
NP_417783
SMR:
P45757
UNIPROT:
P45757


Operon      
Name: gspCDEFGHIJKLMO         
Operon arrangement:
Transcription unit        Promoter
gspCDEFGHIJKLMO
gspCDEFGHIJKLMO
gspCDEFGHIJKLMO


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA
Repressed by: Fur, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB