RegulonDB RegulonDB 10.8: Gene Form
   

gspD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gspD gspE gspA gspC gspF Fur SlyA gspAp4 gspAp4 gspCp3 gspCp3 gspCp2 gspCp2 gspAp1 gspAp1 gspAp2 gspAp2 gspAp3 gspAp3 gspCp1 gspCp1

Gene      
Name: gspD    Texpresso search in the literature
Synonym(s): ECK3312, G7703, b3325, yheF
Genome position(nucleotides): 3456377 --> 3458329 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.18
External database links:  
ASAP:
ABE-0010879
ECHOBASE:
EB2727
ECOO157CYC:
Z4197
ECOO157CYC:
ESCC
OU-MICROARRAY:
b3325
PortEco:
gspD
STRING:
511145.b3325
COLOMBOS: gspD


Product      
Name: Type II secretion system protein GspD
Synonym(s): GspD, YheF
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 70.698
Isoelectric point: 5.334
Motif(s):
 
Type Positions Sequence
598 -> 650 DVYRSLSKEKYTRYRQEQQQRIDGKSKALVGSEDLPVLDENTFNSHAPAPSSR
127 -> 186 TRIVPLENVPARDLAPLLRQMMDAGSVGNVVHYEPSNVLILTGRASTINKLIEVIKRVDV
433 -> 595 ALASNNKNDILATPSIVTLDNKLASFNVGQDVPVLSGSQTTSGDNVFNTVERKTVGTKLKVTPQVNEGDAVLLEIEQEVSSVDSSSNSTLGPTFNTRTIQNAVLVKTGETVVLGGLLDDFSKEQVSKVPLLGDIPLVGQLFRYTSTERAKRNLMVFIRPTIIR
124 -> 188 ELVTRIVPLENVPARDLAPLLRQMMDAGSVGNVVHYEPSNVLILTGRASTINKLIEVIKRVDVIG
345 -> 596 RAQVLVEAIIVEVQDGNGLNLGVQWANKNVGAQQFTNTGLPIFNAAQGVADYKKNGGITSANPAWDMFSAYNGMAAGFFNGDWGVLLTALASNNKNDILATPSIVTLDNKLASFNVGQDVPVLSGSQTTSGDNVFNTVERKTVGTKLKVTPQVNEGDAVLLEIEQEVSSVDSSSNSTLGPTFNTRTIQNAVLVKTGETVVLGGLLDDFSKEQVSKVPLLGDIPLVGQLFRYTSTERAKRNLMVFIRPTIIRD

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0015627 - type II protein secretion system complex
molecular_function GO:0042802 - identical protein binding
biological_process GO:0015031 - protein transport
GO:0009306 - protein secretion
GO:0015628 - protein secretion by the type II secretion system
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7703-MONOMER
ECOLIWIKI:
b3325
ECOO157CYC:
Z4197-MONOMER
ECOO157CYC:
ESCC-MONOMER
INTERPRO:
IPR013356
INTERPRO:
IPR038591
INTERPRO:
IPR005644
INTERPRO:
IPR004846
INTERPRO:
IPR004845
INTERPRO:
IPR001775
PDB:
5WQ7
PFAM:
PF03958
PFAM:
PF00263
PRIDE:
P45758
PRINTS:
PR00811
PROSITE:
PS00875
REFSEQ:
NP_417784
SMR:
P45758
UNIPROT:
P45758


Operon      
Name: gspCDEFGHIJKLMO         
Operon arrangement:
Transcription unit        Promoter
gspCDEFGHIJKLMO
gspCDEFGHIJKLMO
gspCDEFGHIJKLMO


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA
Repressed by: H-NS, Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB