RegulonDB RegulonDB 10.8: Gene Form
   

gspE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gspD gspE gspF gspG gspC

Gene      
Name: gspE    Texpresso search in the literature
Synonym(s): ECK3313, G7704, b3326, yheG
Genome position(nucleotides): 3458339 --> 3459820 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.5
External database links:  
ASAP:
ABE-0010881
ECHOBASE:
EB2728
OU-MICROARRAY:
b3326
PortEco:
gspE
STRING:
511145.b3326
COLOMBOS: gspE


Product      
Name: Type II secretion system protein GspE
Synonym(s): GspE, YheG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 54.611
Isoelectric point: 6.249
Motif(s):
 
Type Positions Sequence
249 -> 256 GPTGSGKS
114 -> 380 AILSEAIKETASDIHIETYEKTMSIRFRIDGVLRTILQPNKKLAALLISRIKVMARLDIAEKRIPQDGRISLRIGRRNIDVRVSTLPSIYGERAVLRLLDKNSLQLSLNNLGMTAADKQDLENLIQLPHGIILVTGPTGSGKSTTLYAILSALNTPGRNILTVEDPVEYELEGIGQTQVNTRVDMSFARGLRAILRQDPDVVMVGEIRDTETAQIAVQASLTGHLVLSTLHTNSASGAVTRLRDMGVESFLLSSSLAGIIAQRLVRR

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
GO:0015627 - type II protein secretion system complex
molecular_function GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0015031 - protein transport
GO:0015628 - protein secretion by the type II secretion system
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7704-MONOMER
ECOLIWIKI:
b3326
INTERPRO:
IPR042181
INTERPRO:
IPR013369
INTERPRO:
IPR027417
INTERPRO:
IPR001482
INTERPRO:
IPR003593
MODBASE:
P45759
PFAM:
PF00437
PRIDE:
P45759
PROSITE:
PS00662
REFSEQ:
NP_417785
SMART:
SM00382
SMR:
P45759
SWISSMODEL:
P45759
UNIPROT:
P45759


Operon      
Name: gspCDEFGHIJKLMO         
Operon arrangement:
Transcription unit        Promoter
gspCDEFGHIJKLMO
gspCDEFGHIJKLMO
gspCDEFGHIJKLMO


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA
Repressed by: Fur, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB