RegulonDB RegulonDB 10.6.3: Gene Form
   

gspF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gspD gspE gspF gspG gspC

Gene      
Name: gspF    Texpresso search in the literature
Synonym(s): ECK3314, G7705, b3327, hofF, hopF
Genome position(nucleotides): 3459817 --> 3461013 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.04
External database links:  
ASAP:
ABE-0010883
ECHOBASE:
EB2722
ECOCYC:
G7705
ECOLIHUB:
gspF
OU-MICROARRAY:
b3327
REGULONDB:
b3327
STRING:
511145.b3327
M3D: gspF
COLOMBOS: gspF
PortEco: b3327


Product      
Name: Type II secretion system protein GspF
Synonym(s): GspF, HofF, HopF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 44.339
Isoelectric point: 10.54
Motif(s):
 
Type Positions Sequence
164 -> 186 LIYPCMLTTVAIGVVIILLTAVV
249 -> 265 LLRVALIGPLICAINSA
220 -> 236 TLLATVFIVAVGFWLWL
267 -> 387 YLRTLSILQSSGVPLLDGMNLSTESLNNLEIRQRLANAAENVRQGNSIHLSLEQTAIFPPMMLYMVASGEKSGQLGTLMVRAADNQETLQQNRIALTLSIFEPALIITMALIVLFIVVSVL
270 -> 270 T

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0015627 - type II protein secretion system complex
molecular_function GO:0008565 - protein transporter activity
biological_process GO:0015031 - protein transport
GO:0009306 - protein secretion
GO:0015628 - protein secretion by the type II secretion system
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7705-MONOMER
ECOLIWIKI:
b3327
INTERPRO:
IPR018076
INTERPRO:
IPR011850
INTERPRO:
IPR003004
INTERPRO:
IPR001992
PANTHER:
PTHR30012
PFAM:
PF00482
PRIDE:
P41441
PRINTS:
PR00812
PROSITE:
PS00874
PROTEINMODELPORTAL:
P41441
REFSEQ:
NP_417786
SMR:
P41441
UNIPROT:
P41441


Operon      
Name: gspCDEFGHIJKLMO         
Operon arrangement:
Transcription unit        Promoter
null
null
null


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA
Repressed by: Fur, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB