RegulonDB RegulonDB 10.8: Gene Form
   

gspH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gspJ gspH gspG gspI gspK

Gene      
Name: gspH    Texpresso search in the literature
Synonym(s): ECK3316, G7707, b3329, hofH, hopH
Genome position(nucleotides): 3461468 --> 3461977 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.08
External database links:  
ASAP:
ABE-0010888
ECHOBASE:
EB2724
OU-MICROARRAY:
b3329
PortEco:
gspH
STRING:
511145.b3329
COLOMBOS: gspH


Product      
Name: Type II secretion system protein GspH
Synonym(s): GspH, HofH, HopH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 18.565
Isoelectric point: 4.304
Motif(s):
 
Type Positions Sequence
1 -> 6 MNQQRG
44 -> 143 AARFTAALELAIDRATLSGQPVGIHFSDSAWRIMVPGKTPSAWRWVPLQEDAADESQNDWDEELSIHLQPFKPDDSNQPQVVILADGQITPFSLLMANAG
7 -> 169 FTLLEMMLVLALVAITASVVLFTYGREDVASTRARETAARFTAALELAIDRATLSGQPVGIHFSDSAWRIMVPGKTPSAWRWVPLQEDAADESQNDWDEELSIHLQPFKPDDSNQPQVVILADGQITPFSLLMANAGTGEPLLTLVCSGSWPLDQTLARDTRP

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0005887 - integral component of plasma membrane
GO:0015627 - type II protein secretion system complex
molecular_function GO:0005515 - protein binding
biological_process GO:0015031 - protein transport
GO:0015628 - protein secretion by the type II secretion system
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7707-MONOMER
ECOLIWIKI:
b3329
INTERPRO:
IPR012902
INTERPRO:
IPR022346
INTERPRO:
IPR002416
PDB:
2KNQ
PFAM:
PF07963
PFAM:
PF12019
PRIDE:
P41443
PRINTS:
PR00885
PROSITE:
PS00409
REFSEQ:
NP_417788
SMR:
P41443
UNIPROT:
P41443


Operon      
Name: gspCDEFGHIJKLMO         
Operon arrangement:
Transcription unit        Promoter
gspCDEFGHIJKLMO
gspCDEFGHIJKLMO
gspCDEFGHIJKLMO


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA
Repressed by: H-NS, Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB