RegulonDB RegulonDB 10.6.3: Gene Form
   

gspI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gspK gspJ gspH gspG gspI

Gene      
Name: gspI    Texpresso search in the literature
Synonym(s): ECK3317, G7708, b3330, yheH
Genome position(nucleotides): 3461974 --> 3462351 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.88
External database links:  
ASAP:
ABE-0010890
ECHOBASE:
EB2729
ECOCYC:
G7708
ECOLIHUB:
gspI
OU-MICROARRAY:
b3330
REGULONDB:
b3330
STRING:
511145.b3330
M3D: gspI
COLOMBOS: gspI
PortEco: b3330


Product      
Name: Type II secretion system protein GspI
Synonym(s): GspI, YheH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 13.901
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
40 -> 113 MRNETLALWIADNQLQSQDSFGEENTSSSGKELINGEEWNWRSDIHSSKDGTLLERTITVTLPSGQTTSLTRYQ
7 -> 125 MTLLEVLLAMSIFTAVALTLMSSMQGQRNAIERMRNETLALWIADNQLQSQDSFGEENTSSSGKELINGEEWNWRSDIHSSKDGTLLERTITVTLPSGQTTSLTRYQSIDNKSGQAQDD
1 -> 26 MNKQSGMTLLEVLLAMSIFTAVALTL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0005887 - integral component of plasma membrane
GO:0015627 - type II protein secretion system complex
molecular_function GO:0008565 - protein transporter activity
biological_process GO:0015031 - protein transport
GO:0015628 - protein secretion by the type II secretion system
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7708-MONOMER
ECOLIWIKI:
b3330
INTERPRO:
IPR012902
INTERPRO:
IPR010052
INTERPRO:
IPR003413
PANTHER:
PTHR38779
PFAM:
PF02501
PFAM:
PF07963
PRIDE:
P45760
PROSITE:
PS00409
PROTEINMODELPORTAL:
P45760
REFSEQ:
NP_417789
SMR:
P45760
UNIPROT:
P45760


Operon      
Name: gspCDEFGHIJKLMO         
Operon arrangement:
Transcription unit        Promoter
null
null
null


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA
Repressed by: Fur, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB