RegulonDB RegulonDB 10.8: Gene Form
   

gspL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gspL gspK gspO gspM gspJ TSS_3834 TSS_3834

Gene      
Name: gspL    Texpresso search in the literature
Synonym(s): ECK3320, G7711, b3333, yheK
Genome position(nucleotides): 3463922 --> 3465085 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.63
External database links:  
ASAP:
ABE-0010896
ECHOBASE:
EB2732
OU-MICROARRAY:
b3333
PortEco:
gspL
STRING:
511145.b3333
COLOMBOS: gspL


Product      
Name: Type II secretion system protein GspL
Synonym(s): GspL, YheK
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cell wall
Molecular weight: 44.54
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
6 -> 232 MVIRSSSTLRKHWEWMTFSADSVSSVHTLTDDLPLESLADQPGAGNVHLLIPPEGLLYRSLTLPNAKYKLTAQTLQWLAEETLPDNTQDWHWTVVDKQNESVEVIGIQSEKLSRYLERLHTAGLNVTRVLPDGCYLPWEVDSWTLVNQQTSWLIRSAAHAFNELDEHWLQHLAAQFPPENMLCYGVVPHGVAAANPLIQHPEIPSLSLYSADIAFQRYDMLHGIFRK
242 -> 260 WLARLAVSCLVLAILSFVG
240 -> 384 GKWLARLAVSCLVLAILSFVGSRSIALWHTLKIEDQLQQQQQETWQRYFPQIKRTHNFRFYFKQQLAQQYPEAVPLLYHLQTLLLEHPELQLMEANYSQKQKSLTLKMSAKSEANIDRFCELTQSWLPMEKTEKDPVSGVWTVRN

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0009276 - Gram-negative-bacterium-type cell wall
GO:0015627 - type II protein secretion system complex
biological_process GO:0015031 - protein transport
GO:0015628 - protein secretion by the type II secretion system
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7711-MONOMER
ECOLIWIKI:
b3333
INTERPRO:
IPR025691
INTERPRO:
IPR024230
INTERPRO:
IPR007812
PFAM:
PF05134
PFAM:
PF12693
PRIDE:
P45763
REFSEQ:
NP_417792
SMR:
P45763
UNIPROT:
P45763


Operon      
Name: gspCDEFGHIJKLMO         
Operon arrangement:
Transcription unit        Promoter
gspCDEFGHIJKLMO
gspCDEFGHIJKLMO
gspCDEFGHIJKLMO


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA
Repressed by: H-NS, Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3834 3464173 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB