RegulonDB RegulonDB 10.7: Gene Form
   

yhgH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bioH yhgH nfuA IscR GntR CRP nfuAp1 nfuAp1 nfuAp2 nfuAp2 TSS_4011 TSS_4011 bioHp bioHp gntXp gntXp

Gene      
Name: yhgH    Texpresso search in the literature
Synonym(s): ECK3400, G7747, b3413, gntX
Genome position(nucleotides): 3544882 --> 3545565 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.99
External database links:  
ASAP:
ABE-0011139
ECHOBASE:
EB2770
OU-MICROARRAY:
b3413
PORTECO:
gntX
REGULONDB:
b3413
STRING:
511145.b3413
M3D: yhgH
COLOMBOS: yhgH
PortEco: b3413


Shine dalgarno      
Sequence: gcaacgccacACTTCGgcattcagtccccatccgtgcagcagcacaagatgaacattcccctgacctttggtctgccaccagatgttattcatccgctattgttctcttttgacttacaaggatgaacatATG


Product      
Name: DNA utilization protein YhgH
Synonym(s): GntX, YhgH, protein involved in utilization of DNA as a carbon source
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.726
Isoelectric point: 11.067
Motif(s):
 
Type Positions Sequence
8 -> 54 CWLCRMPLALGHWGICSVCSRATRTDKTLCPQCGLPATHSHLPCGRC
173 -> 224 RNLKNAFRLELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAAAVQVWCLC

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006308 - DNA catabolic process
GO:0009116 - nucleoside metabolic process
GO:0015976 - carbon utilization
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Palchevskiy V., et al., 2006
External database links:  
ECOCYC:
G7747-MONOMER
ECOLIWIKI:
b3413
INTERPRO:
IPR000836
INTERPRO:
IPR005222
INTERPRO:
IPR029057
MODBASE:
P46846
PFAM:
PF00156
PRIDE:
P46846
PRODB:
PRO_000022828
PROTEINMODELPORTAL:
P46846
REFSEQ:
NP_417872
SMR:
P46846
UNIPROT:
P46846


Operon      
Name: yhgH-nfuA         
Operon arrangement:
Transcription unit        Promoter
gntXY
nfuA
nfuA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: GntR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4011 3544875 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Palchevskiy V., Finkel SE., 2006, Escherichia coli Competence Gene Homologs Are Essential for Competitive Fitness and the Use of DNA as a Nutrient., J Bacteriol 188(11):3902-10

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB