RegulonDB RegulonDB 10.7: Gene Form
   

nfuA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gntT yhgH nfuA GntR GntR CRP IscR TSS_4013 TSS_4013 gntTp3 gntTp3 gntTp2 gntTp2 gntTp1 gntTp1 nfuAp1 nfuAp1 nfuAp2 nfuAp2

Gene      
Name: nfuA    Texpresso search in the literature
Synonym(s): ECK3401, G7748, b3414, gntY, yhgI
Genome position(nucleotides): 3545624 --> 3546199 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.3
External database links:  
ASAP:
ABE-0011144
ECHOBASE:
EB2771
MIM:
605711
MIM:
608100
OU-MICROARRAY:
b3414
PORTECO:
nfuA
REGULONDB:
b3414
STRING:
511145.b3414
M3D: nfuA
COLOMBOS: nfuA
PortEco: b3414


Product      
Name: iron-sulfur cluster carrier protein NfuA
Synonym(s): GntY, NfuA, YhgI, iron-sulfur cluster insertion protein NfuA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.998
Isoelectric point: 4.266
Motif(s):
 
Type Positions Sequence
2 -> 99 IRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMR
44 -> 44 C
39 -> 39 C
149 -> 149 C
152 -> 152 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005829 - cytosol
molecular_function GO:0140132 - iron-sulfur cluster carrier activity
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0042803 - protein homodimerization activity
biological_process GO:0106035 - protein maturation by [4Fe-4S] cluster transfer
GO:0006979 - response to oxidative stress
GO:0016226 - iron-sulfur cluster assembly
GO:0015976 - carbon utilization
GO:0051604 - protein maturation
GO:0010106 - cellular response to iron ion starvation
GO:0097428 - protein maturation by iron-sulfur cluster transfer
Note(s): Note(s): ...[more].
Reference(s): [1] Schumann S., et al., 2012
External database links:  
DIP:
DIP-48001N
ECOCYC:
G7748-MONOMER
ECOLIWIKI:
b3414
INTERPRO:
IPR000361
INTERPRO:
IPR035903
INTERPRO:
IPR001075
INTERPRO:
IPR017726
INTERPRO:
IPR034904
MODBASE:
P63020
PANTHER:
PTHR10072:SF59
PFAM:
PF01106
PFAM:
PF01521
PRIDE:
P63020
PRODB:
PRO_000023378
PRODOM:
PD002830
PROTEINMODELPORTAL:
P63020
REFSEQ:
NP_417873
SMR:
P63020
UNIPROT:
P63020


Operon      
Name: yhgH-nfuA         
Operon arrangement:
Transcription unit        Promoter
gntXY
nfuA
nfuA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: IscR, GntR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4013 3547786 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Schumann S., Alpert C., Engst W., Loh G., Blaut M., 2012, Dextran sodium sulfate-induced inflammation alters the expression of proteins by intestinal Escherichia coli strains in a gnotobiotic mouse model., Appl Environ Microbiol 78(5):1513-22

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB